KEGG   Haliscomenobacter hydrossis: Halhy_4788
Entry
Halhy_4788        CDS       T01491                                 

Definition
(GenBank) phytoene desaturase
  KO
K10209  4,4'-diapophytoene desaturase [EC:1.3.8.2]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00906  Carotenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:hhy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Halhy_4788
Enzymes [BR:hhy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.2  4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming)
     Halhy_4788
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like Pyr_redox_2 FAD_oxidored GDI UDPG_MGDP_dh_N MCRA GIDA 3HCDH_N AlaDh_PNT_C Thi4 IU_nuc_hydro
Other DBs
NCBI-ProteinID: AEE52622
UniProt: F4KXW3
Position
complement(6044644..6046113)
AA seq 489 aa
MKIAIIGAGIAGLASAVRMASKGHSVDVYEANAYPGGKLSQFELQGYRFDAGPSLFTMPQ
YVDELFQAAGLNPAEHFRYQRLPIVCNYFWEDQTRLSAFADETEFASEVEQKLGVEAAKL
LQSLADSRRKYELSGRIFLEKSLHRLDTWLNLSVAKAMLKIPQFDLFTSMNKVNERMVQH
PKLVQLLNRFATYNGSNPYKAPGLLTIIPHFEHHIGAFYPEGGMHNITQSVYELAQSKGA
RFHFNAPVEEILLKKNRAVGIKVNQETLHYDRIISNMDVFHAYRRLLPHAPQPEKILRQE
KSTSALIFYWGVQRESPELNMHNILFSEDYRHEFDLLSQGKVSDDPTVYINITSKHTPGD
APQGCENWFVMINVPYNAGQDWDAIIARSRTQIIAKISRVLGVNLPDLIACEEILEPRSI
ESKTWSHLGALYGTSSNDRMAAFMRHPNFSSKIKNLYFVGGSVHPGGGIPLCLLSAKIVD
EIMDKSPAI
NT seq 1470 nt   +upstreamnt  +downstreamnt
ttgaaaatagccatcattggagcaggaattgcgggcttggcctctgcggtgcgcatggcc
agcaaaggacacagcgtggacgtgtacgaagccaatgcttatcccggcggcaaactctcc
caatttgaactccaaggttaccgctttgacgccgggccttctttgtttacgatgccgcag
tatgtcgacgagttgtttcaagcagccggactcaaccctgcggaacatttccgttaccag
cgcttgcccattgtttgtaattatttttgggaagaccagacccggctctcggcattcgcc
gatgaaacagagtttgccagcgaagtggaacaaaaactgggtgtagaagccgccaaactg
ctccaatccctggccgatagccgccgcaaatacgaactcagcgggcgtatttttttagaa
aaatcattgcaccgcctggatacctggctgaacctgagtgtagccaaagccatgctgaaa
atcccccagtttgacctgttcaccagcatgaacaaagtcaacgaacgaatggtgcaacac
cccaaactggtgcaattgctcaaccgttttgccacttacaatggttccaacccttacaaa
gcgccgggactgctgaccattatcccccattttgagcaccacatcggtgcattttatcct
gagggcgggatgcacaatattactcaatcggtctacgagttggcccaaagcaaaggagcc
aggtttcattttaatgccccggtagaggaaattctgttgaaaaaaaatcgagcagtaggc
atcaaagtaaaccaagaaaccttgcattacgatcgcatcatcagcaatatggatgtgttc
cacgcttaccgccgactcttgccgcatgccccacaacccgaaaaaatcttacgccaggaa
aaatcgacttccgctctgatcttttattggggggtacaacgcgagtctccggaattgaac
atgcacaatattttgttcagtgaagattaccgccacgagttcgatctgctgagccagggg
aaagtgagtgatgaccccaccgtgtacatcaacattacttcaaaacataccccaggcgat
gccccccagggttgtgaaaactggtttgtgatgatcaatgtgccctacaacgccgggcag
gattgggacgccatcattgccaggtctcgcacccaaatcatcgccaaaatcagtcgcgtg
ttgggcgtaaatttacccgatttgattgcttgtgaagaaattctcgagccccgcagcatt
gaaagcaaaacctggtcacatttgggggccttgtacggaacaagttccaacgaccgcatg
gccgccttcatgcggcaccccaattttagttccaaaatcaaaaatttgtattttgtagga
ggcagtgtacatcccggagggggaattccactgtgcctgttgtcggcaaaaattgtggat
gaaattatggacaaatcaccagcaatatga

DBGET integrated database retrieval system