KEGG   Haliscomenobacter hydrossis: Halhy_5239Help
Entry
Halhy_5239        CDS       T01491                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00010  Glycolysis / Gluconeogenesis
hhy00051  Fructose and mannose metabolism
hhy00562  Inositol phosphate metabolism
hhy01100  Metabolic pathways
hhy01110  Biosynthesis of secondary metabolites
hhy01120  Microbial metabolism in diverse environments
hhy01130  Biosynthesis of antibiotics
hhy01200  Carbon metabolism
hhy01230  Biosynthesis of amino acids
Module
hhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hhy_M00002  Glycolysis, core module involving three-carbon compounds
hhy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halhy_5239
   00051 Fructose and mannose metabolism
    Halhy_5239
   00562 Inositol phosphate metabolism
    Halhy_5239
Enzymes [BR:hhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halhy_5239
Exosome [BR:hhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halhy_5239
  Exosomal proteins of bladder cancer cells
   Halhy_5239
  Exosomal proteins of melanoma cells
   Halhy_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE53065
UniProt: F4L605
Position
6673677..6674441
Genome map
AA seq 254 aa AA seqDB search
MKTRQQIVAGNWKMNKNYGEGRELAMEIVERLKPSNTQVVLCAPYIHLQLVKNIIKDVAS
LYLGAQNCHQEDKGAYTGEISVDMLKSVGVSYVILGHSERREYFGESDELLAKKTDKVLA
AGLLPIFCCGESLDIRDAGTHVAHVQAQIKAGLFHLSPEEFQKVVIAYEPIWAIGTGRTA
SPEQAQDMHAAIRALLTDQYGAEIADATTILYGGSVNGGNAAVLFSQPDVDGGLVGGASL
KAEEFITIVEATKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtcaacaaatcgttgctggcaactggaaaatgaacaaaaactacggcgaa
ggccgtgagttggccatggaaattgtggagcgcctgaagccgtccaacacccaggtggtg
ctgtgtgcgccttacatccacctgcaattggtaaaaaacatcatcaaggatgtggccagc
ttgtacctgggcgcgcaaaattgccaccaggaagacaagggcgcctacaccggtgaaatt
tcagtagatatgctcaagtcggttggggtaagctacgtgattctgggccactccgagcgc
cgcgagtattttggcgaatccgatgagctactggccaaaaagacggataaggtgttggcc
gctggcttactacccattttttgttgtggagaaagcctcgacattcgtgatgcgggtacc
catgtagctcatgttcaagcccagatcaaagcgggtttgtttcacctgagcccggaagaa
ttccaaaaagtggtcattgcgtatgagccgatttgggccattggcacgggtcgcacggct
tctcctgagcaggcgcaagacatgcacgcagccattcgcgcacttttgaccgatcaatac
ggcgcggaaattgccgatgctaccaccattctgtatggcggcagtgtcaacggcggcaac
gcggcggtacttttttcacagcccgatgttgatggtggtctggtaggtggtgcttcgctg
aaagcggaggaattcattacgattgtggaagcgacgaagaaataa

DBGET integrated database retrieval system