KEGG   Haliscomenobacter hydrossis: Halhy_5983Help
Entry
Halhy_5983        CDS       T01491                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
hhy  Haliscomenobacter hydrossis
Pathway
hhy00511  Other glycan degradation
hhy00520  Amino sugar and nucleotide sugar metabolism
hhy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Halhy_5983
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Halhy_5983
Enzymes [BR:hhy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Halhy_5983
Chaperones and folding catalysts [BR:hhy03110]
 Intramolecular chaperones
  Others
   Halhy_5983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AEE53806
UniProt: F4L0D3
Position
7644038..7645636
Genome map
AA seq 532 aa AA seqDB search
MPTNRITYYSATLLCAALLTFMGCAPKKAPPISMDLAQESIIPIPVSIKATNSSFELTDA
SEIYVQTGSEELLKIGQFLADKLNPSTGFDFTVKASTAIPDDGNIYLSLKKDAALGDEGY
TLSITPELVHLEANAPAGLFRGVQTIRQLLPAKIEMSSKQEGPWRMASGTINDVPVYAFR
GAMFDVARHFFSVEDTKRYIDLIAAYKMNVMHLHLSDDQGWRIEIKSWPKLAEHGGKTQV
GGGKGGYYTQEQYKDIVQYALDRYITIIPEIDMPGHTNAALAAYPELNCDGKARELYTGT
EVGFSTLCTQNEITYKFIDDVMRELAAMTPGPYIHIGGDESHVTKKEDYIPFVNRVQNIV
LKHGKQVIGWDEIALGTLKKGAFVQHWADVDNAVNAVKQGSKVLMSPARKAYMDMQYDST
TKWGLHWAAYIEVDSAYIWDPATLAPGVTQKDVLGIEAPLWSETVDQIDEVEYMVFPRLP
GYAEIGWSAASARNWGEYKKRLGAHGPRFTAMGINYYPSKLVEWKEEKNQKN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaatcgtataacctactactcagcaacacttttgtgtgctgcattgctaacc
tttatgggctgcgcgcccaaaaaagcacctccaatatccatggatcttgctcaggaaagt
atcattcccattccggtgtccataaaggcgaccaatagttcctttgaattgaccgatgca
tctgaaatttatgtgcagactggatctgaagaactgctaaagattggtcagttcctggcg
gacaaactcaatccatccaccggttttgattttaccgtaaaagcgagtaccgccattccg
gatgatggcaacatttatttgtccctcaaaaaggatgctgcactcggcgacgaaggctat
acgctcagcatcacgccggaattggtacacctggaggccaatgcccccgccgggttgttc
cggggcgtgcaaaccatccgccaattgttgcccgccaaaattgaaatgtccagtaaacag
gaaggcccctggcggatggccagcggtaccatcaatgatgtacctgtctatgcttttcgg
ggcgcgatgtttgatgtggcgcggcattttttcagtgtggaggataccaaacgttacatc
gacctgattgcggcctacaaaatgaacgtgatgcacttgcacttgtcggacgaccagggc
tggcgcatcgaaatcaaatcctggcccaaactggccgaacacggaggcaaaacccaagtg
ggtggcggcaaaggcggctactatacccaggaacaatacaaagacatcgtgcaatacgcc
ctggatcgctacatcaccatcataccagaaatcgacatgcccgggcataccaatgccgca
ctggctgcatatcccgaactgaattgtgatggcaaggctcgggagttgtacacgggcacc
gaagtgggttttagtaccttgtgtacccaaaatgaaatcacctataaattcatcgacgat
gtaatgcgtgaactggccgcaatgacgcctgggccatacatccacatcggcggcgatgag
tcgcacgtgaccaaaaaagaagattacattccttttgtgaaccgggtgcaaaacatcgtc
ttgaagcacggtaagcaggtgattggctgggacgaaattgccctggggactttgaaaaag
ggcgcctttgtacagcactgggccgatgtggacaacgcagtaaacgccgtaaaacaaggc
tccaaagtgctcatgtcgcccgcacgtaaggcttacatggacatgcaatacgactccacc
acgaaatggggcttgcactgggcggcctacatcgaggtggatagcgcctacatttgggac
ccggccactttggctcctggggttacccagaaagatgtcctgggcattgaagcgccactt
tggtcagagacggtggatcaaatcgacgaggtggaatacatggtgttcccgcgtttgccg
gggtatgcggagattggctggtcggcagcaagtgcacggaactggggggagtataagaag
cgtttgggggcacacgggccgcggtttacggcgatggggatcaattattacccgtcgaag
ttggtggagtggaaggaagagaagaatcaaaagaattga

DBGET integrated database retrieval system