KEGG   Haemophilus influenzae CGSHiCZ412602: H733_1258Help
Entry
H733_1258         CDS       T03436                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
hia  Haemophilus influenzae CGSHiCZ412602
Pathway
hia00020  Citrate cycle (TCA cycle)
hia00640  Propanoate metabolism
hia00660  C5-Branched dibasic acid metabolism
hia01100  Metabolic pathways
hia01110  Biosynthesis of secondary metabolites
hia01120  Microbial metabolism in diverse environments
hia01130  Biosynthesis of antibiotics
hia01200  Carbon metabolism
Module
hia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H733_1258
   00640 Propanoate metabolism
    H733_1258
   00660 C5-Branched dibasic acid metabolism
    H733_1258
Enzymes [BR:hia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     H733_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AIB46075
Position
complement(1327556..1328437)
Genome map
AA seq 293 aa AA seqDB search
MAILIDKNTKVICQGFTGGQGTFHSEQALAYGTQLVGGVSPNKGGTTHLGLPVFNTVREA
VENTGATATVIYVPASFCKDAIIEAIDAGIQLIVCITEGIPTLDMLKVKQKLNETGVVMI
GPNCPGVITPDESKIGIMPAHIHKKGKVGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG
DPILGSSFIDILERFQQDPETEAIVMIGEIGGSAEEEAAIFIKDNVTKPVVAYIAGITAP
KGKRMGHAGAIISGGKGTAVEKIAALEAAGVTCVKSLAEIGEALRKLLKSSKN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttaattgataaaaataccaaagtgatttgccaaggttttactggtggacaa
gggacttttcattctgaacaagcattggcctacggaacgcaattagtcggtggcgtatcg
ccaaataaaggtggaaccactcatcttggtttacctgtatttaatacagttcgtgaagct
gtcgaaaatacgggggcaacagcgacggtcatttatgtgccagcatcattttgtaaagat
gccataattgaagccattgatgcagggattcagttaattgtctgtattactgaaggtatt
cctacattggatatgcttaaggtaaaacaaaaattaaatgaaacaggcgttgtgatgatt
gggccaaattgcccaggtgtgattacgcctgatgaatctaaaatcggcattatgccagct
cacatacataaaaaaggtaaagtggggattgtttctcgttctggaactttaacttatgaa
gcagtaaaacaaactacagatgaaggctttggacaatcgacttgtgtgggtatcggggga
gatcctattctgggttctagttttattgatattctcgaaagatttcaacaagatcccgaa
acagaagccattgtgatgattggcgagattggcggctctgcagaggaagaagcggcaatc
ttcattaaagataacgtcactaaaccagtggttgcctatattgcgggtatcactgcgcca
aaaggcaaacggatggggcatgcgggagccattattagcggcggaaaaggtactgcagta
gaaaaaattgcagcgttagaagccgctggtgtgacctgtgtaaaaagccttgctgaaatt
ggtgaagccttgagaaagctattaaaatcatctaaaaattaa

DBGET integrated database retrieval system