KEGG   Haemophilus influenzae C486: NTHIC486_00082Help
Entry
NTHIC486_00082    CDS       T03721                                 

Gene name
folA
Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
hic  Haemophilus influenzae C486
Pathway
hic00670  One carbon pool by folate
hic00790  Folate biosynthesis
hic01100  Metabolic pathways
Module
hic_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NTHIC486_00082 (folA)
   00670 One carbon pool by folate
    NTHIC486_00082 (folA)
Enzymes [BR:hic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NTHIC486_00082 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AJO88855
Position
78000..78482
Genome map
AA seq 160 aa AA seqDB search
MTFSLIVATTLNNVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQLFEHDGVVWKGSLESAVDFVRDFDEIMLIGGGELFKQYLPKADKLYLTQIQTEL
DGDTFFPQLNWEEWEIEFDEYRKADEQNRYDCRFLILTRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacatttagtttaattgtggcgacaacattaaataatgtgattggtaaagataaccaa
atgccttggcatttgcctgcagatttagcttggtttcgtcagaacaccactggtaaacct
gtcattatggggcgtaaaacctttgaaagtattggtcgtccactacctaaacgtaccaat
atcgtactttctcgccagctttttgaacacgacggtgtggtatggaaaggtagccttgaa
agtgcggtcgattttgtcagagattttgatgaaattatgctgattggtgggggagagtta
ttcaaacaatatttgcccaaagcagataagttataccttactcaaattcaaacagaacta
gatggcgatacttttttccctcaattgaattgggaggagtgggaaattgaatttgatgaa
tatcgtaaggcagatgaacaaaatcgctatgattgccgatttttaattcttacccgaaaa
taa

DBGET integrated database retrieval system