KEGG   Haemophilus influenzae C486: NTHIC486_01389Help
Entry
NTHIC486_01389    CDS       T03721                                 

Gene name
metG
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hic  Haemophilus influenzae C486
Pathway
hic00450  Selenocompound metabolism
hic00970  Aminoacyl-tRNA biosynthesis
hic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NTHIC486_01389 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NTHIC486_01389 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hic01007]
    NTHIC486_01389 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hic03016]
    NTHIC486_01389 (metG)
Enzymes [BR:hic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NTHIC486_01389 (metG)
Amino acid related enzymes [BR:hic01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NTHIC486_01389 (metG)
Transfer RNA biogenesis [BR:hic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NTHIC486_01389 (metG)
 Prokaryotic type
   Other AARSs
    NTHIC486_01389 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 UME
Motif
Other DBs
NCBI-ProteinID: AJO90073
UniProt: A0A5C6H0N2
Position
1413952..1416000
Genome map
AA seq 682 aa AA seqDB search
MTTQPRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNKIHFVCADDAHGTPIM
LNADKLGITPEELIAKAKADHMRDFAGFNISFDNYHSTHSEENKQLTAEIYNKLKANGFI
KSKVISQLFDPEKNMFLPDRFVKGTCPKCKAEDQYGDNCEVCASTYSPMDLINPRSAVSG
TTPIVKESEHFFFDLPAFEGMLKEWTRSGSLQSEIANKMQEWFESGLQQWDISRDTPYFG
FEIPGVKDKFFYVWLDAPIGYMASFKNLCNREGIDFNEFWAEGSDAELYHFIGKDIVYFH
SLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFIQASTYLNHIDPECLRYYYAA
KLNDRIEDLDFNLEDFVQRVNTDIVNKLVNLASRNAGFIAKRFEGKLADKLEDEALFAEF
TAQAEQIAAYYESREYNKAIREIMALTDKANKYIDEKAPWVIAKEEGKEAELQAVCSMGI
ELFRVLMSYLKPVLPKLAERAETFLQAELRWDNIHQPLLGHTLAPFKALFSRLEKKQIDA
VVEETKALFAAANKAAEKTEAKPTALSTVEPIAETITIDDFAKLDMRVAKVLKCEAVPES
NKLLRFELDLGDHTRQVFSSIKAAYNKPEELEGRFVIMVANLAPRKMKFGVSEGMILSAG
TGGSDLFLLSADSGVTAGMQVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaccccgtaaaattttagtcacttgcgccttgccttatgccaatggggca
attcatttaggccatatgttagaacatatccaagcggatatttgggtgcgttttcaacgt
atgcgtggcaataaaatccattttgtctgtgcagatgatgcgcacggcacaccgattatg
ctgaatgccgataaacttggcattacacctgaagaattaattgctaaagcaaaagccgat
cacatgcgtgattttgcaggtttcaatattagttttgataactatcattccactcacagc
gaagaaaacaaacaactcactgcagaaatttacaataaactcaaagccaatggctttatt
aagagtaaagttatttctcagttattcgaccctgaaaaaaatatgttcttgcctgatcgt
tttgtgaaaggcacttgcccgaaatgtaaagcagaagatcaatatggcgataactgcgaa
gtgtgtgcatctacttacagcccaatggatttaattaatcctcgttcagctgtttctggc
acaacacctatcgtaaaagaatctgaacactttttctttgacttgcctgcatttgaaggc
atgttaaaagaatggacacgttctggctcacttcaatctgaaattgccaacaaaatgcaa
gaatggtttgagagcggtttacaacaatgggatatttcacgcgatacgccttatttcggt
tttgaaattccgggcgtaaaagataaattcttctatgtttggttagatgcaccaatcggc
tatatggcttcattcaaaaatctatgcaatcgtgaaggcattgatttcaatgaattttgg
gcggaaggcagtgatgcggaactttatcatttcatcggtaaagacatcgtttatttccac
agcctattctggcctgcaatgcttgaaggcagtggctatcgtaaaccgactaatgtgttc
gctcatggctatgtcacggtggatggggcgaagatgtcaaaatctcgcggcacattcatt
caagccagcacttatttgaatcatatcgatcctgaatgtttgcgttattactatgcagca
aaattaaatgatcgcattgaagatttagactttaaccttgaagatttcgtacaacgtgta
aatacagatatcgtaaacaaattagtgaatttagcttcacgcaatgcaggttttattgcg
aaacgctttgaaggcaaacttgcggataaactggaagacgaagcattatttgcagaattt
accgctcaagccgagcaaatcgccgcttattacgaaagccgtgaatacaataaagccatt
cgtgaaattatggcattaacggataaagccaataaatatattgatgaaaaagccccttgg
gtaattgcaaaagaagaaggcaaagaggcagaattgcaagccgtatgttcaatgggtatt
gagcttttccgcgtattgatgtcttacttaaaacccgttcttccaaaactagcagaacgt
gcagaaaccttcttacaagctgaattacgttgggataatattcatcaaccattgcttggt
catacccttgcaccgtttaaagccttattctctcgtttagagaaaaaacaaattgatgcc
gttgtagaagaaaccaaagccttatttgcagcagccaataaagcagcagaaaaaactgaa
gcaaaaccaaccgcactttctaccgttgaacctattgctgaaaccatcacgattgatgat
ttcgctaaacttgatatgcgtgtagcaaaagtattgaaatgcgaagcagtgccagaatct
aataaacttttacgttttgaattggatcttggcgatcatactcgtcaagtcttctctagc
attaaagcggcttacaataaacctgaagaattagaaggtcgttttgtgattatggtggca
aaccttgcaccacgtaaaatgaaattcggcgtgtctgagggaatgattctatccgcagga
acaggcggtagtgatttattcttactttctgctgatagcggtgtcactgcgggcatgcaa
gtaaaataa

DBGET integrated database retrieval system