KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0463Help
Entry
R2846_0463        CDS       T01980                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Brite
KEGG Orthology (KO) [BR:hie00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hie03009]
    R2846_0463 (rluD)
Enzymes [BR:hie01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     R2846_0463 (rluD)
Ribosome biogenesis [BR:hie03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    R2846_0463 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 NepR TruB_N
Motif
Other DBs
NCBI-ProteinID: ADO95904
Position
464831..465805
Genome map
AA seq 324 aa AA seqDB search
MPQITLSAEVQPEQMGQRLDQTLAELFPEYSRSRLKTWIEADLVKLNDRITNIPREKVLG
GERIEIIVEVEDETRFEAENIPLNIVYEDDDIIVINKPKDLVVHPGAGNPNGTVLNALLY
HYPPISEVPRAGIVHRLDKDTTGLMVVAKTIPAQTKLVRDLQKRKITREYEAVASGIMTK
GGTVDQPMARHATKRTLMAVHPMGKPAVTHYRIMENYRNYTRLRLRLETGRTHQIRVHMA
HIAHPLLGDQTYGGRPRPPKNASEDFMEVLRNFKRQALHAVMLRLAHPITGEMMEWYAPL
PDDFVELLNALKADYLEHQDELDY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaattaccctttcggctgaagtgcagccagaacaaatgggacaacgtttagac
caaacacttgcagagttgttccctgaatattctcgttcccgattaaaaacatggattgaa
gccgatctcgtaaaacttaacgaccgcattactaatattccgcgtgagaaagtgcttgga
ggagagagaatagagattattgttgaagtggaagatgaaacacgttttgaagcagaaaat
attccattgaatattgtgtatgaagatgatgatattattgtgattaacaaacccaaagat
cttgtggtacaccctggtgctggcaatccaaatggaactgtactcaatgcgttactctat
cattatccaccgatatcagaagtacctcgtgcaggaattgtgcatcgattagataaagat
acgacaggtctaatggttgttgcgaaaactattccagcacaaactaagttagtgcgagac
ttacaaaaacgcaaaattacgcgcgaatatgaagcagtcgcttcaggcattatgactaaa
ggtggcacagtagatcaacctatggctcgtcatgcaaccaaacgtactttaatggctgtt
catccaatgggaaaaccagctgttactcattatcgtattatggaaaattaccgtaactac
acccgtttacgtttacgtttagaaacggggcgcacccatcaaatccgcgttcatatggca
catattgctcatccattgctaggcgatcaaacctatggcggacgccctcgtccacccaaa
aatgcgagtgaagactttatggaagtattgcgtaatttcaaacgccaagctttacatgcg
gtcatgttacgcttagctcatccaattacaggggaaatgatggaatggtatgcaccatta
ccagatgactttgttgaattgcttaatgccctcaaagccgactatctcgaacatcaagat
gagttagattattaa

DBGET integrated database retrieval system