KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_1028Help
Entry
R2846_1028        CDS       T01980                                 

Gene name
bioF
Definition
(GenBank) Probable 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00780  Biotin metabolism
hie01100  Metabolic pathways
Module
hie_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:hie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    R2846_1028 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hie01007]
    R2846_1028 (bioF)
Enzymes [BR:hie01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     R2846_1028 (bioF)
Amino acid related enzymes [BR:hie01007]
 Aminotransferase (transaminase)
  Class II
   R2846_1028 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GUN4_N Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADO96427
Position
complement(1075892..1077034)
Genome map
AA seq 380 aa AA seqDB search
MDAFKQQLEQLSAKNQYRSIPDLVHQGRYIMRENRKMLNMSSNDYLGLASNENLRQSFLQ
QYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTT
KSLILADKLVHASMIDGIRLSQCEFFRYRHNDYEHLKSLLEKNAGKFDRTFIVTESVFSM
DGDVADLKQLVQLKKQFSNTYLYVDEAHAVGVYGQNGLGIAERANVIADIDLLVGTFGKA
LASMGAYVVCDQILKECLINQMRPLIFSTALPPFNVAWTHFIFERLPQLSKERTHLEQLS
AFLRQEVEHRTQIMPSQTCIVPYILGENEATLAKAKDLQEQGYYCLPIRPPTVPKGTSRI
RLSLTADMTMDEVKQFVACL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggatgctttcaaacagcaactggaacagcttagcgcaaaaaatcaatatcgttcaatt
ccagacttagttcatcaaggacgatatattatgcgagaaaatcgcaaaatgctgaatatg
tcatctaatgattatttaggtttggcatcaaatgaaaacttgcgccagtcttttttgcag
caatatggcggtaattttccctcttttaccagttcttcatcgcgtttattaacgggcaac
tttcctatttataccgatttggaagagcttgtcgcacaacgtttccaacgagaaagcgcg
ttattgttcaacagcggctatcacgccaatatcggcattttgcctgctttgacgacgacg
aaaagtttgattttggcagataaattagtgcatgccagcatgattgatggcattcgttta
agccaatgtgagttctttcgttatcgtcataatgattatgaacatctaaagagtctgctc
gaaaaaaatgctggaaaatttgaccgcacttttatcgttaccgaatctgttttcagtatg
gatggcgacgtggcggatttgaaacagcttgttcaattaaaaaaacaattttccaatact
tatctttatgtggatgaagcccacgccgtcggtgtttatgggcaaaacggattgggtatt
gccgaacgagctaatgtgatagctgatatagatttgttggttggcacttttggcaaggcc
ttagcttcaatgggggcttatgtcgtctgtgatcaaatattaaaagaatgtttgattaat
caaatgcgtccattgattttttcaaccgcacttccgccctttaatgtggcttggactcat
tttatttttgaacgattaccacaactttcaaaagaaagaacgcatcttgagcagttaagt
gcatttttacgccaagaagtggaacacagaacgcaaataatgccaagccaaacctgcata
gttccctatattttaggcgagaacgaagcaacccttgctaaggcgaaagatctgcaagag
caaggttattattgcttgccgattagaccaccaacagtaccaaaaggtacatccagaata
cgattgtctttgacggcagatatgacaatggatgaagtgaaacagtttgtggcatgctta
taa

DBGET integrated database retrieval system