KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_1111Help
Entry
R2846_1111        CDS       T01980                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Pathway
hie00230  Purine metabolism
hie00250  Alanine, aspartate and glutamate metabolism
hie01100  Metabolic pathways
Module
hie_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hie00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    R2846_1111 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    R2846_1111 (purA)
Enzymes [BR:hie01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     R2846_1111 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF2661
Motif
Other DBs
NCBI-ProteinID: ADO96505
Position
1161136..1162434
Genome map
AA seq 432 aa AA seqDB search
MGKSVVILGAQWGDEGKGKIVDLLTDRVKYVVRYQGGHNAGHTLIINGEKTVLRLIPSGM
LHPNVTCLIGNGVVVSPEALMKEMGELESRGIKVRERLLISEACPLILPYHVAMDHAREA
ALGKKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKEAFAEKLKNILEYYNFQLVNYYKVE
PVDYQKTLDDVMAIADVITGMVADITTILDTARKNGEHILFEGAQGTMLDIDHGTYPYVT
SSNTTAGGVATGSGFGPRNLDYVLGIIKAYCTRVGGGPFTTELFDDVGAEIARKGNEFGA
VTGRPRRCGWFDAVAIRRAIQLNSISGFCMTKLDVLDGFDEVKICVAYKMPNGEIVEYAP
LAAKDWEGVEPIYETLPGWKENTFRITDVNKLPQNCINYIKRIEEVTGVPIDILSTGPDR
VETMILRDPFAA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaagcgttgttatcttaggcgcacaatggggcgatgaaggtaaaggaaaaatc
gttgatcttttgacggatcgcgtaaaatacgtagttcgttatcaaggcggccataacgca
ggtcacacacttattatcaatggcgaaaaaaccgtattacgtttaattccatctggtatg
ttacatccaaacgtaacttgcttaattggtaatggcgttgtggtttcgcctgaagcatta
atgaaagaaatgggcgaacttgaaagccgaggtattaaagttcgtgaacgtttattaatt
tcagaagcttgtcctttgattctgccttatcacgttgcaatggatcacgcacgcgaagca
gcccttggcaaaaaagctataggtacaactggtcgtggtattggcccagcttatgaagat
aaagtagctcgtcgtggtttacgcgtaggcgatttatttaataaagaagcctttgccgaa
aaactcaaaaacatccttgaatactataatttccaattggtgaactactacaaagttgaa
cctgtcgattatcaaaaaaccttagatgatgtaatggcaattgccgatgtaatcacaggt
atggtggcagatatcactacaattcttgatactgcgcgcaaaaatggcgaacatatttta
tttgaaggcgcacaagggacaatgttagatatcgaccacggtacttatccgtatgtaacc
agctcaaacacaacggctggtggtgttgcaacaggctctggttttggcccgcgtaatctt
gattatgtacttggtatcattaaggcttactgtactcgtgtaggtggtggcccattcaca
actgaattatttgatgatgtaggtgctgaaattgcacgtaaaggtaacgaatttggtgcg
gtaacaggccgtccacgtcgttgcggttggttcgatgccgtcgccattcgtcgtgcaatc
caacttaactctatttctggtttctgtatgactaaactagacgtattagatggttttgat
gaagtaaaaatctgtgttgcttacaaaatgccaaatggcgaaatcgttgaatatgcaccg
ttagcggcgaaagattgggaaggtgtagaaccaatttatgaaacattaccaggttggaaa
gaaaatactttccgcatcacagatgtaaataaattgccacaaaactgcattaactatatt
aaacgtattgaagaagtaactggcgtacctattgatattctttcaactggccctgatcgt
gtagaaacaatgattttacgtgatccgttcgctgcttaa

DBGET integrated database retrieval system