KEGG   Haemophilus influenzae Hi375: NF38_00195Help
Entry
NF38_00195        CDS       T03485                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
hih  Haemophilus influenzae Hi375
Pathway
hih00770  Pantothenate and CoA biosynthesis
hih01100  Metabolic pathways
Module
hih_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NF38_00195
Enzymes [BR:hih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     NF38_00195
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     NF38_00195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AIT66702
UniProt: A0A0Y7J7V5
Position
complement(41707..42909)
Genome map
AA seq 400 aa AA seqDB search
MNLNGKRVVVGITGGIAAYKTIELIRLLRKAEAEVRVVLTPAAAEFVTPLTLQAISGNAV
SQSLLDPQAELAMGHIELAKWADAIIIAPASADFIARLTVGMANDLLSTICLATDAPIFL
VPAMNQQMYHQSITQQNLTTLQTRGIELIGPNSGFQACGDMGKGRMSEPEEIFTALSDFF
SQKQDLQGLNVAITAGPTREAIDPVRYISNHSSGKMGFAIAEAFAKRGANVTLISGPVNL
TTPKNVNRINVISAQEMWQASLESAVKNQIFIGCAAVADYRVAEVAEQKIKKSGDEISIK
LIKNPDIISDVGHLKTHRPFTVGFAAETQNIDDYAKDKLERKNLDMICANDVSGGQVFNA
DENALQLFWKNGHKKLSLKSKVELAADLVNEIIERYQKTL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaacggaaaacgtgttgtcgtcggtattacgggcggcattgcagcctataaa
acaatagagttgattcgtttattacgcaaagcagaagctgaagtacgtgtagtattaacc
ccagctgcagcagaatttgttactcctttgacacttcaagccatttctggcaatgctgta
tcgcaatctttacttgatccacaagcagagctggcaatggggcatattgaacttgccaaa
tgggctgatgccattattattgcgccagctagtgcagactttattgcccgtcttactgta
ggcatggcgaatgatttactttcaacaatttgtcttgcaactgatgcgccaatttttctt
gtgccagcaatgaatcagcagatgtatcaccaatccattactcaacaaaatttaacgact
cttcaaacacgtgggattgagcttatcggccccaatagtggttttcaagcttgcggcgat
atggggaaagggcgtatgtcagaaccagaggaaatttttaccgcactttctgactttttc
tctcaaaaacaagatctacaaggattaaatgtcgccattacagcaggcccaacgcgtgag
gcaatcgatcccgttcgttatatttctaaccatagttcagggaaaatgggatttgcgatt
gctgaagcatttgccaaacgtggggcaaacgtcacactgatttcaggcccagtgaattta
acaacaccaaaaaatgtaaatcgaattaatgtcatctcagcacaagaaatgtggcaagcc
tctcttgaaagtgcggtaaaaaatcaaatttttattggttgtgcggctgttgctgattac
agagtagctgaagttgcagaacaaaaaatcaaaaaatctggcgatgaaatatctatcaag
ttaattaaaaatcccgatattatctcagatgtaggacatttaaaaacacatcgtcctttt
actgttggatttgcagccgaaacccaaaatattgatgattatgcaaaagataaacttgaa
cgcaaaaatcttgatatgatttgtgccaacgatgtatctggcggacaagtttttaacgcg
gatgaaaatgccttgcagcttttttggaaaaatggtcataaaaaattatcgctaaaatca
aaagtagaacttgccgctgatttagtcaatgaaatcatcgaacgctatcaaaaaacctta
taa

DBGET integrated database retrieval system