KEGG   Haemophilus influenzae Hi375: NF38_01090Help
Entry
NF38_01090        CDS       T03485                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hih  Haemophilus influenzae Hi375
Pathway
hih00071  Fatty acid degradation
hih00280  Valine, leucine and isoleucine degradation
hih00310  Lysine degradation
hih00380  Tryptophan metabolism
hih00620  Pyruvate metabolism
hih00630  Glyoxylate and dicarboxylate metabolism
hih00640  Propanoate metabolism
hih00650  Butanoate metabolism
hih00900  Terpenoid backbone biosynthesis
hih01100  Metabolic pathways
hih01110  Biosynthesis of secondary metabolites
hih01120  Microbial metabolism in diverse environments
hih01130  Biosynthesis of antibiotics
hih01200  Carbon metabolism
hih01212  Fatty acid metabolism
hih02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NF38_01090
   00630 Glyoxylate and dicarboxylate metabolism
    NF38_01090
   00640 Propanoate metabolism
    NF38_01090
   00650 Butanoate metabolism
    NF38_01090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NF38_01090
   00072 Synthesis and degradation of ketone bodies
    NF38_01090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NF38_01090
   00310 Lysine degradation
    NF38_01090
   00380 Tryptophan metabolism
    NF38_01090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NF38_01090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NF38_01090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NF38_01090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hih04147]
    NF38_01090
Enzymes [BR:hih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NF38_01090
Exosome [BR:hih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NF38_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIT66877
Position
214603..215784
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIIPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggcgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
atccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system