KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_000446Help
Entry
HifGL_000446      CDS       T02839                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Pathway
hik00071  Fatty acid degradation
hik00280  Valine, leucine and isoleucine degradation
hik00310  Lysine degradation
hik00380  Tryptophan metabolism
hik00620  Pyruvate metabolism
hik00630  Glyoxylate and dicarboxylate metabolism
hik00640  Propanoate metabolism
hik00650  Butanoate metabolism
hik00900  Terpenoid backbone biosynthesis
hik01100  Metabolic pathways
hik01110  Biosynthesis of secondary metabolites
hik01120  Microbial metabolism in diverse environments
hik01130  Biosynthesis of antibiotics
hik01200  Carbon metabolism
hik01212  Fatty acid metabolism
hik02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hik00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HifGL_000446 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    HifGL_000446 (atoB)
   00640 Propanoate metabolism
    HifGL_000446 (atoB)
   00650 Butanoate metabolism
    HifGL_000446 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HifGL_000446 (atoB)
   00072 Synthesis and degradation of ketone bodies
    HifGL_000446 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HifGL_000446 (atoB)
   00310 Lysine degradation
    HifGL_000446 (atoB)
   00380 Tryptophan metabolism
    HifGL_000446 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HifGL_000446 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HifGL_000446 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HifGL_000446 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hik04147]
    HifGL_000446 (atoB)
Enzymes [BR:hik01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HifGL_000446 (atoB)
Exosome [BR:hik04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HifGL_000446 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGV11279
Position
complement(459244..460425)
Genome map
AA seq 393 aa AA seqDB search
MENVVIISAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattattagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaatattgaaagtgcattagttaatgaagtcatcatgggaaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggcattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggagacattattgtttcacgagacgagtatcct
aaagcagataccacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacaattcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttgggcttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system