KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_01010Help
Entry
HICON_01010       CDS       T01400                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00020  Citrate cycle (TCA cycle)
hil00640  Propanoate metabolism
hil00660  C5-Branched dibasic acid metabolism
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01120  Microbial metabolism in diverse environments
hil01130  Biosynthesis of antibiotics
hil01200  Carbon metabolism
Module
hil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HICON_01010
   00640 Propanoate metabolism
    HICON_01010
   00660 C5-Branched dibasic acid metabolism
    HICON_01010
Enzymes [BR:hil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HICON_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBY87386
Position
complement(1798679..1799848)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKQLFEHYGLPVKNGAVCQSVEDVDLVLAQLSGDKWAAKCQVHAGGRGKAGGV
KLVQDVEEARAFAEKWLGQRLVTFQTDKLGQPVNQIYFEETCDIDKEFYLSAVVDRASQK
VMFIASPAGGMNIEEVAQNSPHLLHKVEIDPLFGGLPYQGRELAFKLGLSGTQNKQFTDI
FMGLSRLFLEKDLSLVEVNPLVLTPQGNLVCLDAKISVDDNALFRHKDLLALQDLTQNDA
REAEAEKFQLNYVALEGDIGCMVNGAGLAMGTMDIVKLYGGKPANFLDVGGGATQERVAE
AFKIILTDPSVKVILVNIFGGIVRCDLIAEGVIAAVNEVGVRVPVVVRLEGTNAEIGRQI
LVESDVNILTAQSLQQAAELAVNAAKGEH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaagcaaaacaactatttgagcattatggattacccgtaaaa
aatggggcggtctgtcaatctgttgaggatgtcgatttggtactggctcaactttctggc
gataagtgggcagcgaaatgccaagttcatgctggtgggcgtggtaaagcgggtggcgtt
aaattggtacaggatgtagaggaagcgagagcttttgcagaaaaatggctgggacaacgt
ttagtcacttttcaaacggataaattgggtcagccagtaaaccagatttattttgaagaa
acttgcgatattgataaagaattttacttaagtgcggttgttgatcgtgcctctcaaaaa
gttatgtttattgcttctcctgctggtggaatgaatattgaagaagttgcacaaaattca
ccgcacttactccataaagtcgagattgatcctttatttggaggattgccttatcaaggc
cgtgaattggcgtttaaattagggttaagtggtacgcaaaacaaacagtttaccgatatc
tttatgggcttatctcgtttgtttttagaaaaagatttatctttagtggaagtcaatcca
cttgttctcactccacaaggcaatttggtttgtctcgatgccaaaatatctgtcgatgat
aacgctttatttcgccataaagatctcttagcactgcaagatttaactcaaaatgatgcc
cgtgaagcagaagctgaaaaattccagttaaactatgtggctttagagggcgacattggt
tgtatggtaaacggggcagggcttgcaatgggcaccatggatattgtgaaactctatggt
gggaagcctgcgaattttcttgatgtgggtggtggtgcaacgcaagagcgggttgctgaa
gcgttcaaaatcattttaaccgatccttccgttaaagtgattttagtgaatatttttggt
ggtattgttcgttgtgatttgattgctgaaggcgtgattgcggcagtaaatgaagtgggc
gtgagagtgcctgtggttgtgcgattagaaggaacgaatgctgaaatcggtcgccaaatt
ttagtggaaagtgacgttaatattcttaccgcacagagtttacaacaagccgcagaatta
gccgtgaatgcagcaaaaggagaacactaa

DBGET integrated database retrieval system