KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_05860Help
Entry
HICON_05860       CDS       T01400                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00010  Glycolysis / Gluconeogenesis
hil00052  Galactose metabolism
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01120  Microbial metabolism in diverse environments
hil01130  Biosynthesis of antibiotics
Module
hil_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HICON_05860
   00052 Galactose metabolism
    HICON_05860
Enzymes [BR:hil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HICON_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim AphA_like
Motif
Other DBs
NCBI-ProteinID: CBY86049
Position
336860..337882
Genome map
AA seq 340 aa AA seqDB search
MLEQTTFNAPDGAPYQLITLQNENGMRVQFMDWGATWLSCKVPVNDTLREVLLGCKVENY
PTHQSYLGASVGRYANRIANAQFELNGELIKLSSNQGKHQLHGGEGFDKRRWKIQECGEN
FVCFSLQSEHGDQGFPGNVDVSVTYTLTDDNSVKIEYAGICDKDTALNLTNHAYFNLENA
EQGSDVREHTLRLNADFYLPVDNEGIPNSPLKHVVNTSFDFRIAKPIKQDFLQGDQQATK
GYDHSFIVNKAWQKPCVLLTSPTGDLSLEVRTSQAALQVYTGNYLAGTPTRNGELYADFS
GIALETQCLPDTPNHPEWQNYGGIQKASEQYYQWTEFKFK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaaaccacttttaatgcgcctgatggtgcaccttatcagcttataaccctg
caaaatgaaaatgggatgcgtgttcaatttatggattggggcgcaacttggctttcttgt
aaagtgccagtaaatgacacattacgcgaggttttattgggttgtaaggtagagaattac
cccactcatcaaagctatttaggcgcaagcgtagggcgttatgcaaatcgtattgcaaat
gcacaatttgaattgaatggcgaacttattaaattaagtagtaatcaaggaaagcaccag
cttcatggtggagagggttttgataaacgtcgttggaaaattcaagagtgcggtgagaat
tttgtgtgtttttcattacagtcagagcatggtgatcagggttttcctgggaatgtggat
gtgtctgtaacctatacgctaacagatgataatagcgtaaaaattgaatatgcagggatt
tgtgataaggataccgcattgaacctaacgaatcacgcctatttcaatttagaaaatgca
gagcaaggcagtgacgtgcgtgaacatacattacgtttaaatgctgatttttatctgcct
gtagataatgaggggattcctaattctccattaaagcacgtagtgaatacgagttttgac
ttccgtattgctaaacccatcaagcaagattttttacaaggggatcagcaagcaacaaaa
ggttacgatcattcctttattgtcaataaagcttggcaaaagccttgtgtgttactaacc
tctccaactggcgatttaagtttggaagtaagaacctcgcaagctgcattgcaggtttat
acgggtaattatcttgcaggtacaccaacgagaaatggcgaattatatgccgatttttct
ggcatagcactagaaacccaatgtttacccgacacgccaaatcatcctgaatggcaaaat
tacggcggaattcaaaaagcaagcgagcaatattatcaatggacagagtttaaatttaaa
taa

DBGET integrated database retrieval system