KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_15100Help
Entry
HICON_15100       CDS       T01400                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00450  Selenocompound metabolism
hil00970  Aminoacyl-tRNA biosynthesis
hil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HICON_15100
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HICON_15100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hil01007]
    HICON_15100
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hil03016]
    HICON_15100
Enzymes [BR:hil01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HICON_15100
Amino acid related enzymes [BR:hil01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HICON_15100
Transfer RNA biogenesis [BR:hil03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HICON_15100
 Prokaryotic type
   Other AARSs
    HICON_15100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 UME
Motif
Other DBs
NCBI-ProteinID: CBY86971
Position
complement(1353597..1355645)
Genome map
AA seq 682 aa AA seqDB search
MTTQPRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNKIHFVCADDAHGTPIM
LNADKLGITPEELIAKAKADHIRDFAGFNISFDNYHSTHSEENKQLTAEIYNKLKANGFI
KSKVISQLFDPEKNMFLPDRFVKGTCPKCKAEDQYGDNCEVCASTYSPMDLINPRSAVSG
ATPVVKESEHFFFDLPAFEGMLKEWTRSGSLQSEIANKMQEWFESGLQQWDISRDAPYFG
FEIPGAKDKFFYVWLDAPIGYMASFKNLCDREGIDFNEFWAEGSDAELYHFIGKDIVYFH
SLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFIQASTYLNHIDPECLRYYYAA
KLNDRIEDLDFNLEDFVQRVNTDIVNKLVNLASRNAGFIAKRFEGKLADKLEDETLFAEF
TAQAEQIAAYYESREYNKAIREIMALTDKANKYIDEKAPWVIAKEEGKEAELQAVCSMGI
ELFRVLMSYLKPVLPKLAEHAEAFLQAELRWDNIHQPLLGHTLAPFKALFSRLEKKQIDA
VVEETKALFAAANKAAEKTEAKPTALSAVEPIAETITIDDFAKLDMRVAKVLKCEAVPES
NKLLRFELDLGDHTRQVFSGIKAAYNKPEELEGRFVIMVANLAPRKMKFGVSEGMILSAG
TGGGDLFLLSADSGVTAGMQVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaccccgtaaaattttagtcacttgcgccttgccttatgccaatggggca
attcatttaggccatatgttagaacatatccaagcggatatttgggtgcgttttcaacgt
atgcgtggcaataaaatccattttgtctgtgcggacgatgcgcacggcacgcctattatg
ctgaatgccgataaacttggcattacacctgaagaattaattgctaaagcaaaagccgat
cacattcgtgattttgcaggtttcaatattagttttgataactaccattctactcacagc
gaagaaaacaaacagctcactgcagaaatttacaataaactcaaagccaatggctttatt
aagagtaaagttatttctcagttattcgatcctgaaaaaaatatgttcttgcctgatcgt
tttgtgaaaggcacttgcccgaaatgcaaagcagaagatcaatatggcgataactgcgaa
gtgtgcgcttctacttatagcccaatggatttaattaatcctcgttcagctgtttctggt
gcaacacctgtagtaaaagaatctgaacactttttctttgacttgcctgcatttgaaggc
atgttaaaagaatggactcgttctggctcacttcaatctgaaattgcgaacaaaatgcaa
gaatggtttgaaagcggtttacaacaatgggatatttcacgcgatgcgccttatttcggt
tttgaaattccaggtgcaaaagataaattcttctatgtttggttagatgcaccaatcggc
tatatggcttcattcaaaaatctatgcgatcgtgaaggcattgatttcaacgaattttgg
gctgaaggcagtgatgcggagctttatcatttcatcggtaaagatatcgtttatttccac
agtctattctggcctgcaatgcttgaaggcagtggctatcgtaaaccgactaatgtgttc
gctcatggctatgtcacggtggatggggcgaagatgtcaaaatctcgcggcacattcatt
caagccagcacttatttgaatcatatcgatcctgaatgtttgcgttattactatgcagca
aaattaaatgatcgcattgaagatttagactttaaccttgaagatttcgtacaacgtgtc
aatacggatattgtaaacaaattagtaaatttggcttcacgcaatgcgggctttattgcg
aaacgctttgaaggcaaacttgcggataaactggaagatgaaacattatttgcagaattt
accgcccaagccgagcaaatcgccgcttattacgaaagccgtgaatacaataaagccatt
cgtgagattatggcattaacggataaagccaataaatatattgatgaaaaagccccttgg
gtaattgcaaaagaagaaggcaaagaggcagaattgcaagccgtatgttcaatgggtatt
gagcttttccgcgtgttgatgtcttacttaaaacctgttcttccaaaactggcagaacat
gcagaagccttcttacaagctgaattacgttgggataatattcatcaaccattacttggt
catacccttgcaccgtttaaagccttattctctcgtttagagaaaaaacaaattgatgcc
gttgtggaagaaaccaaagccttatttgcagcagccaataaagccgctgaaaaaacagaa
gcaaaaccaaccgcactttctgccgttgaacctattgctgaaaccatcacgattgatgat
ttcgctaaacttgatatgcgtgtagcaaaagtattgaaatgcgaagcagtgccagaatct
aataaacttttacgttttgaattagatcttggtgatcatactcgtcaagtcttctctggc
attaaagcggcttacaataaaccagaagaattagaaggtcgttttgtgattatggtggca
aaccttgcaccacgtaaaatgaaattcggtgtatctgaaggaatgattctatccgcagga
acaggcggtggtgatttattcttgttatctgccgatagcggtgtcactgcgggcatgcaa
gtaaaataa

DBGET integrated database retrieval system