KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17320Help
Entry
HICON_17320       CDS       T01400                                 

Definition
(GenBank) tRNA pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Brite
KEGG Orthology (KO) [BR:hil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hil03016]
    HICON_17320
Enzymes [BR:hil01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HICON_17320
Transfer RNA biogenesis [BR:hil03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    HICON_17320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CBY87118
Position
1506989..1507708
Genome map
AA seq 239 aa AA seqDB search
MLEILYQDEFLVAVNKPAGMLVHRSWLDPHETQFVMQTLRDQIGQHVFPIHRLDRPTSGV
LLFALSSEIANLMCEQFEQKCVQKSYLAVVRGYLQGKERIDYPLKIQLDKIADKFSQEDK
EPQEAVTDYEGLKIVEMPYPAGRYQTARYSLVKLIPHTGRKHQLRRHMKHIFHPILGDTQ
YGDLHQNRALMSHLGCSRLFLHSDSLSFIHPITKEQITITAGLDEQWQQLMNQFGWENV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaattttatatcaagatgagtttctcgttgcggtgaataaacctgctggtatg
ctggttcatcgcagttggttagatcctcacgaaactcaatttgtgatgcaaaccttgcga
gatcaaattggccaacatgtatttcctattcatcgtttagatcgaccgacatctggcgtg
ttgttatttgcattgagcagtgaaattgcgaatttaatgtgtgaacagtttgaacaaaag
tgtgttcagaaatcttatttggctgtagtgcgtgggtatctacagggaaaagagcggata
gattatccactaaaaattcaattggataaaatcgcagataaattttctcaagaagataaa
gagcctcaagaagcagtgactgattatgaaggattaaaaatagtcgaaatgccttatcct
gctgggcgttatcaaacggcgcgttattctttagttaaattaatccctcatacaggtaga
aaacaccaattacgtcgccatatgaaacatatttttcatccgattttaggggatacgcaa
tatggtgacttacatcaaaatcgtgcattaatgtcacatttaggttgttctcgattattt
ttacattctgatagtttgtcttttattcatccaataacgaaagagcaaataacaattaca
gcaggtttagatgaacaatggcagcaattaatgaatcaatttggatgggaaaatgtttga

DBGET integrated database retrieval system