KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0102Help
Entry
HI0102            CDS       T00001                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00300  Lysine biosynthesis
hin01100  Metabolic pathways
hin01120  Microbial metabolism in diverse environments
hin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HI0102 (dapE)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HI0102 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 950999
NCBI-ProteinID: NP_438276
UniProt: P44514
Structure
PDB: 

Position
complement(108685..109818)
Genome map
AA seq 377 aa AA seqDB search
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEP
VIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANP
NHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAG
TGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGK
LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL
GKCGEIYHKMLVNLLDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagtggtttcgttggcacaagatttaattcgtcgcccgtctattagccca
aatgacgaaggctgtcagcaaattattgccgaacgtttagaaaaattaggttttcaaatt
gaatggatgccttttaatgacacgttgaatttgtgggcaaaacacggaacgagcgagcca
gttattgcttttgcaggtcatacggatgttgtgcctactggcgatgaaaatcaatggtcg
tctccgccgttttctgcggagattattgatggcatgctttatgggcgtggtgcggcggat
atgaaaggctcccttgcagcaatgattgtggcggcagaagaatacgtaaaagcaaatcct
aatcataaaggcaccattgcattattgattacctctgatgaagaggctaccgcaaaagat
ggaactatacacgtggttgagacgttaatggcgcgtgatgaaaaaattacttattgtatg
gttggcgagccatcgagtgctaaaaacttaggagatgttgtcaaaaatggtcgccgcggc
tcaattacaggaaatctctatattcaaggtattcaaggacacgtagcctatccgcattta
gctgaaaacccaatccataaagcagcgctatttttgcaagaattaacgacttaccaatgg
gataaaggcaatgaatttttcccgccaacaagcctacaaattgctaacattcacgcgggt
acgggaagtaataatgtaattcctgctgagttatatattcagttcaatttgcgttattgc
acagaagtcacggatgaaatcattaagcaaaaagtggctgaaatgctagaaaaacacaat
ttgaaatatcgtattgaatggaatttatcaggcaaaccctttttaacaaaaccaggtaaa
ttattagattcgataacctccgctattgaggaaaccataggcataacgccaaaggctgaa
acaggtggcggcacgtcagacggtcgttttattgcattgatgggcgcagaagtagtggaa
tttggcccgttaaattcaaccattcataaagtcaatgaatgtgtcagtgtagaagacctt
ggcaagtgcggtgaaatttaccacaaaatgttagtgaatttattggatagctaa

DBGET integrated database retrieval system