KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0260Help
Entry
HI0260            CDS       T00001                                 

Definition
(RefSeq) deoxyribonucleotide triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HI0260
Enzymes [BR:hin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     HI0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 949383
NCBI-ProteinID: NP_438428
UniProt: P44598
Position
complement(289511..290098)
Genome map
AA seq 195 aa AA seqDB search
MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE
KSGLPAIADDSGLVVSALNGAPGLYSARYAGEEGNDAKNREKLLAELAHIAQEQRQAKFV
SCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETAEKKK
ISHRAKALSVLKSKL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaatcgtacttgctacaggcaataaaggaaaagtaaaagaaatggctgat
gtcctatctgattttggctttgaagtgattgcacaaacagatttaggcattgaaagccca
gaagagacaggcttaacttttgtagagaatgccttattaaaagcccgttatgcctcagag
aaatcaggtttacctgctattgcagatgattctggcttagtagtttccgcacttaatggc
gcaccaggtctgtattctgcccgttatgctggtgaagagggcaatgatgctaaaaaccgt
gagaaattattggcagagcttgctcatattgcacaagaacaacgccaagccaaatttgtg
agctgtatcgtgtttttacagcatccaacggatccatcgccaattatcgccgaaggtgag
tgttgtggcgtgattggttttgaagaaaaaggcgaaaatggctttggttatgacagttta
ttctttagtccagaacaaggttgcacatttgctgaattagaaacagctgagaagaaaaaa
atttctcatcgagcaaaggcattgagtgttttaaaaagtaaattataa

DBGET integrated database retrieval system