KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0516Help
Entry
HI0516            CDS       T00001                                 

Gene name
rplA
Definition
(RefSeq) 50S ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hin00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HI0516 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hin03011]
    HI0516 (rplA)
Ribosome [BR:hin03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    HI0516 (rplA)
  Bacteria
    HI0516 (rplA)
  Archaea
    HI0516 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1 DUF1840
Motif
Other DBs
NCBI-GeneID: 949582
NCBI-ProteinID: NP_438674
UniProt: P44342
Position
complement(539465..540154)
Genome map
AA seq 229 aa AA seqDB search
MAKLTKKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVR
GATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDA
MRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANF
SEVQLKENLQALLAALNKAKPTTAKGIFIKKVSISTTMGAGVAVDQASL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattgactaaaaaaatgaaagcaatcaaagctggcgtagattctactaaagca
tacgaaattaacgaagcgattgcggtattaaaacaattcgcaacggctaaattcgttgaa
agtgttgatgttgcagtaaacttaggtatcgatcctcgtaaatctgaccaaaacgttcgt
ggtgcaactgtattaccacacggtactggtcgtgaagtacgtgtagctgtgttcactcaa
ggtgctaacgcagatgcagctaaagaagctggtgctgatttagtaggtatggaagattta
gcagagcaaatcaaaaaaggcgaaatgaactttgatgttgttatcgcttctcctgatgca
atgcgtgttgttggtcaattaggtcaagtattaggcccacgtggtttaatgccaaaccct
aaagttggtactgtaacaccaaacgttgctgaagcagttaaaaatgctaaatctggtcag
atccgttatcgtaatgataaaaacggtatcatccacaccactatcggtaaagcaaacttc
tctgaagttcaattaaaagaaaatcttcaagcattattggctgctttaaataaagcaaaa
ccaactactgctaaaggtattttcatcaagaaagtaagcatctctaccactatgggtgca
ggtgttgctgttgatcaagcttctttataa

DBGET integrated database retrieval system