KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0738Help
Entry
HI0738            CDS       T00001                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00290  Valine, leucine and isoleucine biosynthesis
hin00770  Pantothenate and CoA biosynthesis
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01130  Biosynthesis of antibiotics
hin01210  2-Oxocarboxylic acid metabolism
hin01230  Biosynthesis of amino acids
Module
hin_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
hin_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HI0738 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HI0738 (ilvD)
Enzymes [BR:hin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     HI0738 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 949825
NCBI-ProteinID: NP_438897
UniProt: P44851
Position
792641..794479
Genome map
AA seq 612 aa AA seqDB search
MPKLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQFVPGHVHLKDMGQLV
AAEIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTKLSDQLIRLDLVDAMIEAADPNVSDER
IDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSMLATHADRKELFLKAGRQIV
ELCKRYYEQDDASVLPRSIGTFDAFENAMSLDIAMGGSSNTVLHLLAAAQEAGVDFKMED
IDRLSRKVPCLSKIAPNTNKYHMEDVHRAGGIMGLLGELDRAGLIHKNTHTVLGMSMGEQ
LDQYDIIRNQDEELHKFFRAGPAGIRTTQAFSQDCRWDTVDNDRVNGCIRNKENAISQEG
GLAVLFGNLAEDGCIVKTAGVDESIWKFTGTAIVFESQEDAVAGILGGKVKEGHVVVIRY
EGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFSGGTSGLSIGHVSPEAASGGAIGL
VRNGDIINIDIPNRAINLEISNEELATRRAEQDQKGWQPANREREVSFALKVFGHFATSA
DKGAVRDKTLLK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactacgttcagcgaccagcacacaaggtcgtaatatggcaggcgcacgtgcc
ttatggcgtgcaacaggaatgaaagaaaatgactttggtaaaccgattattgcggtggtg
aactctttcacgcaattcgtaccagggcatgtgcatttaaaagatatgggacagcttgtt
gccgcagaaatagaaaaagcgggcggcgtagcaaaagaatttaacaccattgcggtggat
gatggtatcgcaatgggtcacggtggaatgctttattctttaccaagccgtgatttaatc
gctgatagcgtggaatatatggtcaatgcacactgtgctgatgcgatggtgtgtatttct
aactgtgacaaaatcaccccgggaatgttaatggcggcaatgcgcttaaacattccgaca
atttttgtttcaggcggcccaatggaagcgggcaaaacaaaactttctgatcaattaatc
cgcttagatttggttgatgcgatgattgaggcagccgatccgaatgtatcagatgaacgt
attgatgccatcgaacgcagtgcgtgtccaacttgtggttcatgttctggtatgtttacc
gctaactcaatgaactgcttaactgaagccttaggtttatctttacctggtaatggttct
atgttagccactcacgcagaccgtaaagaattattcttaaaagcaggtcgtcaaattgtc
gagctttgcaaacgctattatgaacaagatgatgcaagcgtattgcctcgttcaatcggt
acttttgatgcctttgaaaatgcaatgagcctcgatatcgcaatgggtggttcaagtaac
actgttttacacttattagcggcagcacaagaagcaggcgtggattttaaaatggaagat
attgaccgtttatcgcgcaaagtgccttgtttaagcaaaattgcaccaaacaccaataaa
tatcatatggaagacgtacaccgtgcaggcggtattatgggattgttgggtgaattagat
cgtgctggattaattcataaaaatacacacaccgtgcttggaatgagcatgggagagcaa
ctagaccaatacgatattattcgcaatcaagatgaagaattacataaattcttccgtgca
ggccctgcaggtatccgcacaactcaagcattctcacaagattgccgctgggataccgtt
gataatgatcgtgtaaacggttgtattcgcaataaagaaaatgcgatttcacaagaaggt
ggcttagccgtattattcggtaatctcgctgaagacggatgtatcgttaaaaccgctggt
gtagatgaatctatttggaaattcactggcacggcaatcgtatttgaaagccaagaagat
gcggttgcaggcattttaggtggcaaagtcaaagaaggtcatgttgttgttatccgttac
gaagggcctaaaggcggaccaggtatgcaagaaatgttatacccaaccagttacttaaaa
tcgatgggcttgggcaaaaaatgcgctttattaacggatggtcgcttctctggcggtaca
tcaggcttgtctattggacatgtttcaccagaagctgcttctggcggtgcaatcggctta
gtacgcaatggcgatattatcaacattgatattccaaaccgtgcaattaacttagaaatc
agtaatgaagaactcgcaacacgcagagccgaacaagatcaaaaaggttggcagccagct
aaccgtgaacgtgaagtatctttcgctttaaaagtattcggtcactttgcgacctcagcg
gacaaaggtgcggtacgcgataaaacattattaaaataa

DBGET integrated database retrieval system