KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0771Help
Entry
HI0771            CDS       T00001                                 

Gene name
atoB
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00071  Fatty acid degradation
hin00280  Valine, leucine and isoleucine degradation
hin00310  Lysine degradation
hin00380  Tryptophan metabolism
hin00620  Pyruvate metabolism
hin00630  Glyoxylate and dicarboxylate metabolism
hin00640  Propanoate metabolism
hin00650  Butanoate metabolism
hin00900  Terpenoid backbone biosynthesis
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
hin01200  Carbon metabolism
hin01212  Fatty acid metabolism
hin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HI0771 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    HI0771 (atoB)
   00640 Propanoate metabolism
    HI0771 (atoB)
   00650 Butanoate metabolism
    HI0771 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HI0771 (atoB)
   00072 Synthesis and degradation of ketone bodies
    HI0771 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HI0771 (atoB)
   00310 Lysine degradation
    HI0771 (atoB)
   00380 Tryptophan metabolism
    HI0771 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HI0771 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HI0771 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HI0771 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hin04147]
    HI0771 (atoB)
Enzymes [BR:hin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HI0771 (atoB)
Exosome [BR:hin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HI0771 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 950638
NCBI-ProteinID: NP_438930
UniProt: P44873
Position
complement(833490..834671)
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgcgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagcgatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaagggatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system