KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0818Help
Entry
HI0818            CDS       T00001                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00010  Glycolysis / Gluconeogenesis
hin00052  Galactose metabolism
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
Module
hin_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI0818 (galM)
   00052 Galactose metabolism
    HI0818 (galM)
Enzymes [BR:hin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HI0818 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim AphA_like
Motif
Other DBs
NCBI-GeneID: 949661
NCBI-ProteinID: NP_438978
UniProt: P31765
Position
complement(868882..869904)
Genome map
AA seq 340 aa AA seqDB search
MLEQTTFNAPDGAPYQLITLQNENGMRVQFMDWGATWLSCKVPVNDTLREVLLGCKVDNY
PTHQSYLGASVGRYANRIANAQFELNGELIKLSSNQGKHQLHGGEGFDKRRWNIQECGEN
FVCFSLHSVDGDQGFPGNVDVSVTYTLTGDNSVKIEYAGMCDKDTALNLTNHTYFNLENA
EQGSDVREHTLRLNADFYLPVDNEGIPNSPLKHVVNTSFDFRIAKPIKQDFLQGDQQATK
GYDHSFIVNKAWQKPCVLLTSPTGDLSLEVRTSQAALQVYTGNYLAGTPTRNGELYADFS
GIALETQCLPDTPNHPEWQNYGGIQKAGGRYYQWTEFKFK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaaaccacttttaatgcgcctgatggtgcaccttatcagcttataaccctg
caaaatgaaaatgggatgcgtgttcaatttatggattggggcgcaacttggctttcttgt
aaagtgccagtaaatgacacattacgcgaggttttattgggttgtaaggtagataattat
cccactcatcaaagctatttaggcgcaagcgtagggcgttatgcaaatcgtattgcaaat
gcacaatttgaattgaatggcgaacttattaaattaagtagtaatcaaggtaaacatcag
cttcatggtggagagggctttgataaacgccgttggaacattcaagagtgcggtgagaat
tttgtgtgtttttcattacattcagtggatggtgatcaaggttttcctggtaatgtggat
gtgtctgtaacctatacgctaacaggtgataatagcgtaaaaattgaatatgcagggatg
tgcgataaggatactgcattgaacctaacgaatcatacttatttcaatttagaaaatgca
gagcaaggcagtgacgtgcgtgaacatacattacgtttaaatgctgatttttatctgcct
gtagataatgaggggattcctaattctccattaaagcacgtggtgaatacaagttttgac
ttccgtattgctaaacccatcaagcaagattttttacaaggggatcagcaagcaacaaag
ggttacgatcattcctttattgtcaataaagcttggcaaaagccttgtgtgttactaacc
tctccaactggcgatttaagtttggaagtaagaacctcgcaagctgcattgcaggtttat
acgggtaattatcttgcaggtacaccaacgagaaatggcgaattatatgccgatttttct
ggcatagcactagaaactcaatgtttaccagatacgccaaatcatcctgaatggcaaaat
tacggcggaattcaaaaagcaggcgggcgatattatcaatggacagagtttaaatttaaa
taa

DBGET integrated database retrieval system