KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1204Help
Entry
HI1204            CDS       T00001                                 

Gene name
ackA
Definition
(RefSeq) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00430  Taurine and hypotaurine metabolism
hin00620  Pyruvate metabolism
hin00640  Propanoate metabolism
hin00680  Methane metabolism
hin01100  Metabolic pathways
hin01120  Microbial metabolism in diverse environments
hin01200  Carbon metabolism
Module
hin_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HI1204 (ackA)
   00640 Propanoate metabolism
    HI1204 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    HI1204 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HI1204 (ackA)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HI1204 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 949638
NCBI-ProteinID: NP_439360
UniProt: P44406
Position
complement(1270934..1272139)
Genome map
AA seq 401 aa AA seqDB search
MSKLVLILNCGSSSLKFAILDPATGEEKLSGLAEAFFLPEARIKWKLNGEKGNADLGAGA
AHTEALNFIASNILNDELKNSIAAIGHRIVHGGEKYTQSVIVTDEVVKGIEDAAQFAPLH
NPAHLIGIREAFKAFPHLKDKNVVVFDTAFHQTMPEEAFLYALPYSLYKEHGVRRYGAHG
TSHYFVSREVAKYVGKPADQVNAIICHLGNGGSVSVVRNGQCIDTSMGLTPLEGLVMGTR
CGDIDPAIVFYLYKTLGMSMDQIEETLVKKSGLLGLTEVTSDCRYAEDNYDDESKPETRR
ALNVYSYRLAKYIGAYMAVLGDDHLDAIAFTGGIGENSAHVRELALNHLKLFGIKIDNER
NLATRFGKDGVITTDDSAFKAIVLPTNEELVIAQDTAKLCF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacttgttcttatccttaactgtggtagttcttcactcaaatttgcaattctt
gatccagcaacaggggaagaaaaattatctggcttagccgaagcatttttcttaccagaa
gcacgtatcaaatggaaactcaatggagagaaaggtaacgcagatttaggcgcaggcgca
gcgcatactgaagcacttaattttatcgcatctaacattctgaatgatgagcttaaaaat
tctatcgcggcaattggtcatcgtatcgttcacggtggcgaaaaatacactcaatctgtc
atcgtaacagatgaagttgttaaaggaattgaagatgctgcacaatttgcgccacttcac
aaccctgctcacttaattggtattcgcgaagcattcaaggcattcccacacttaaaagat
aaaaacgtggtagtttttgatacagcattccaccaaactatgcctgaagaagccttcctt
tatgcccttccatactctttatataaagaacacggcgtacgtcgctatggtgcacacggc
acaagtcactacttcgtttctcgtgaagtcgctaaatatgtaggcaaacctgcagatcaa
gtaaatgctattatttgtcacttaggtaatggtggttctgtttctgttgtgcgtaacggt
caatgtattgatacttcaatgggcttaactccgctagaaggtttagtaatgggtacgcgt
tgtggcgatattgaccctgcaatcgtattctacctatacaaaacactaggtatgtctatg
gatcaaatcgaagagactttagtgaaaaaatcgggtcttttaggtttaactgaagtaaca
agcgactgccgttatgctgaagataactacgatgatgaatctaaaccagaaacaagacgt
gctttaaatgtttatagctatcgtttagcgaaatacattggtgcttatatggctgtgttg
ggcgatgatcacttagatgcaattgcattcactggtggtattggcgaaaactcagcgcac
gttcgtgaattagccttaaatcacttaaaattattcggcattaaaatcgataacgaacga
aatcttgccacacgttttggtaaagatggtgtaatcaccactgatgattccgcatttaaa
gcaattgttcttccaactaacgaagaattggttatcgcacaagataccgcaaaactttgt
ttctaa

DBGET integrated database retrieval system