KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1322Help
Entry
HI1322            CDS       T00001                                 

Gene name
recD
Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HI1322 (recD)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HI1322 (recD)
DNA repair and recombination proteins [BR:hin03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HI1322 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD-helicase DUF2075 AAA_28 AAA_18 AAA_16 T2SSE KBP_C NTPase_1 UvrD_C DUF724 AAA_24
Motif
Other DBs
NCBI-GeneID: 950249
NCBI-ProteinID: NP_439473
UniProt: P45158
Position
1400144..1402066
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKELRILSQGDYYFAKLIADKQCHTDYAEPVKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIVQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSHSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQAAYLLATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLELFDHYPQELHFN
SLNDEGDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQVQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagctgcgcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatacggattatgcggaaccagtcaaaaat
ttagccatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggcttggcttatcgcactacagaagaa
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgtgcgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggca
tttcaatttggcgcgttgtatttctatcgcgcttggcaagatgaatatcgcatcgtgcaa
tatataaaaaataccttaaaaaaataccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accacgacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaggctgcatctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatgtatcccattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaatgcctttaatgattacacacga
tataacagccataaccctttgcagttggatgtattagttgttgatgaaacatcaatgatt
gatttaccaatgatggcaaaacttatcaatgcattaaagcccgaaactcgattaatttta
ttaggcgatcaggcgcaattagcctctgttgaggcgggggctgtattgggggaattggct
caatttgttactcaaccttatagtcatgaacaagccgcatacttactagcaacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttgtccgaattcattcaaaaa
ggcaaagcagacgatagccttgagttatttgaccattatccgcaagaattgcactttaat
tccttaaatgatgaaggcgatgcggtcaatcaagtggtaaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaagtgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataacgttcgcctttataacggcgatattggacta
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaaaccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttcagaatttaaacat
accgtcatggtgcttccaacagaagtaaatccagtattgtcgcgagaattagttttcacg
ggtgtcactcgtgcaaaaaaagaacttactgtatttgctgatgaaaaaatatggaaaaca
gcaattcgccagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system