KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1393Help
Entry
HI1393            CDS       T00001                                 

Gene name
hindIIIR
Definition
(RefSeq) type II restriction endonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Brite
KEGG Orthology (KO) [BR:hin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hin02048]
    HI1393 (hindIIIR)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HI1393 (hindIIIR)
Prokaryotic defense system [BR:hin02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HI1393 (hindIIIR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_HindIII Pox_L5 FCH
Motif
Other DBs
NCBI-GeneID: 950303
NCBI-ProteinID: NP_439547
UniProt: P43870
Structure
PDB: 

Position
complement(1491780..1492682)
Genome map
AA seq 300 aa AA seqDB search
MKKSALEKLLSLIENLTNQEFKQATNSLISFIYKLNRNEVIELVRSIGILPEAIKPSSTQ
EKLFSKAGDIVLAKAFQLLNLNSKPLEQRGNAGDVIALSKEFNYGLVADAKSFRLSRTAK
NQKDFKVKALSEWREDKDYAVLTAPFFQYPTTKSQIFKQSLDENVLLFSWEHLAILLQLD
LEETNIFXFEQLWNFPKKQSKKTSVSDAENNFMRDFNKYFMDLFKIDKDTLNQLLQKEIN
FIEERSLIEKEYWKKQINIIKNFTREEAIEALLKDINMSSKIETIDSFIKGIKSNDRLYL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtgcgttagagaaattattatcactgatagaaaatttaactaatcaagaa
tttaaacaggcaactaatagtttaatctcatttatttataaattgaatagaaatgaggtt
attgaattggttagatctattggaatacttcctgaggcaataaaaccaagttctacacaa
gagaaattattctcaaaagcaggagatattgtattagctaaagcttttcaattacttaat
ctgaactcaaaaccattagaacagagaggtaatgctggagatgtgatagcactctctaaa
gaatttaattacggcttagttgctgatgctaaatcttttcgacttagtcgtactgctaaa
aatcaaaaagattttaaagtaaaagcgttaagtgaatggcgagaagataaggattatgca
gtattaacagcaccattttttcaatatcctacaactaaaagtcaaatttttaagcaatcg
ttagatgaaaatgttttgttatttagttgggaacatttagctatattattacagttagat
ttagaggaaactaatatttttycttttgagcaattatggaactttcccaaaaagcaaagt
aaaaaaacatctgtatctgatgctgaaaataattttatgagagattttaataaatacttt
atggatttatttaaaatagataaagatactttaaatcaacttcttcaaaaagagatcaat
tttattgaagaaagatccttgatagaaaaggaatattggaaaaaacaaataaatattata
aaaaattttacaagagaagaagccatagaagcattattgaaagatataaatatgtcttca
aaaatagaaactattgatagttttattaaagggataaaaagtaatgatagactgtattta
taa

DBGET integrated database retrieval system