KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1739.2Help
Entry
HI1739.2          CDS       T00001                                 

Gene name
murI
Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00471  D-Glutamine and D-glutamate metabolism
hin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HI1739.2 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hin01011]
    HI1739.2 (murI)
Enzymes [BR:hin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     HI1739.2 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:hin01011]
 Precursor biosynthesis
  Racemase
   HI1739.2 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-GeneID: 950882
NCBI-ProteinID: NP_439883
UniProt: P52973
Position
complement(1823723..1824532)
Genome map
AA seq 269 aa AA seqDB search
MDKKEKRPTVLFFDSGVGGFSVYREAKKLLPNWHYLYCFDNAGFPYSERKEESIIHRTLA
ACQLINQRYPLDAMVIACNTASTVVLPPLRAAFDIPIIGTVPAIKPASEITKTKHIGLLA
TKGTVKRHYIDELIDKFAQDCIVERLGTTKLVEIAEQKIRGHSVDLISLKDELSSWAGMA
DLDTLVLGCTHFPLIKDEIQLCLPQVKYFMEPSAAIAKRIKYLLDDKNLQAQNEKYNQMF
CTAHFPEESQFKKALHLWGFESLEVIKID
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagaaaaacgcccaacagtgctcttttttgattctggagtgggtgggttt
agcgtatatcgtgaagccaaaaaactattacccaattggcattatctctattgctttgat
aatgcgggattcccttattcagaacgcaaagaagaaagtattattcaccgaactttagcg
gcgtgtcagcttattaatcaacgttatccattagatgcaatggtgatagcttgcaataca
gcgagtactgttgtgcttccgcctttgcgagctgcttttgatattcctatcattgggact
gtacccgctattaaacctgcatcagaaataacaaagacaaaacatattggtttattagct
acaaaggggactgtaaaacgtcattatatcgatgagttgattgataaatttgcgcaagat
tgtattgttgagagactgggaacgacaaaattagtcgaaattgcggagcaaaaaattcgt
ggtcattccgttgatctcattagtttaaaagatgagttatcttcgtgggcaggcatggca
gatttggatacattagttttaggttgtactcactttcctctcatcaaagatgaaattcag
ttatgcttgccacaagttaaatattttatggaaccgagcgcagcaattgctaaacggatc
aaatatttacttgatgataaaaatctacaagcgcaaaatgaaaaatataatcaaatgttt
tgcaccgcacattttcccgaagaatctcaatttaaaaaagctttacatctatggggattt
gaatctttggaagtaatcaaaatagattaa

DBGET integrated database retrieval system