KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_02440
Entry
CGSHiEE_02440     CDS       T00543                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00620  Pyruvate metabolism
hip00640  Propanoate metabolism
hip00650  Butanoate metabolism
hip01100  Metabolic pathways
hip01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGSHiEE_02440
   00640 Propanoate metabolism
    CGSHiEE_02440
   00650 Butanoate metabolism
    CGSHiEE_02440
Enzymes [BR:hip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CGSHiEE_02440
SSDB
Motif
Pfam: PFL-like Gly_radical PBP_dimer
Other DBs
NCBI-ProteinID: ABQ97933
Position
complement(479357..481669)
AA seq 770 aa
MSELNEMQKLAWAGFAGGDWQENVNVRDFIQKNYTPYEGDDSFLAGPTEATTKLWESVME
GIKIENRTHAPLDFDEHTPSTIISHAPGYINKDLEKIVGLQTDEPLKRAIMPFGGIKMVE
GSCKVYGRELDPKVKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIG
DYRRVALYGVDFLMKDKYAQFSSLQKDLEDGVNLEATIRLREEIAEQHRALGQLKQMAAS
YGYDISNPATNAQEAIQWMYFAYLAAIKSQNGAAMSFGRTATFIDVYIERDLKAGKITET
EAQELVDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETIAGMGLDGRTLVTKNTFRILHT
LYNMGTSPEPNLTILWSEQLPENFKRFCAKVSIDTSSVQYENDDLMRPDFNNDDYAIACC
VSPMIVGKQMQFFGARANLAKTLLYAINGGIDEKLGMQVGPKTAPITDEVLDFDTVMTRM
DSFMDWLAKQYVTALNVIHYMHDKYSYEAALMALHDRDVYRTMACGIAGLSVAADSLSAI
KYAKVKPVRGDIKDKDGNVVATNVAIDFEIEGEYPQYGNNDNRVDDIACDLVERFMKKIQ
KLKTYRNAVPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLT
SVAKLPFAYAKDGISYTFSIVPNALGKDAEAQRRNLAGLMDGYFHHEATVEGGQHLNVNV
LNREMLLDAMENPDKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTESM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgtcagaacttaatgaaatgcaaaaattggcgtgggctggttttgctggtggcgattgg
caagaaaatgtcaatgtacgtgactttatccaaaaaaactataccccttatgaaggcgat
gactctttcttagcaggtccaaccgaagcaacaaccaagctttgggaatctgtaatggaa
ggaattaaaattgaaaaccgtactcacgcgccattagattttgatgaacatacaccatct
accattatctctcacgcacctggttacattaacaaagatttagaaaaaatcgttggtctt
caaactgatgaacctttaaaacgtgccattatgccattcggtggtatcaaaatggtggaa
ggttcttgtaaagtttatggtcgtgaacttgatccaaaagtgaaaaaaatcttcactgaa
taccgtaaaacacataaccaaggtgtattcgatgtttacacgccagatattttacgttgc
cgtaaatctggggtattaactggtcttccagatgcttatggtcgtggtcgtatcatcggt
gactaccgtcgtgtagcactttatggtgtagatttcttaatgaaagataaatacgcgcaa
ttctcttctttacaaaaagatttagaagatggcgtaaatcttgaagcaacaattcgttta
cgtgaagaaatcgcagaacaacaccgtgcattaggtcaattaaaacaaatggcagcaagc
tatggttatgatatttctaacccagcaactaatgctcaagaagctattcaatggatgtac
tttgcttatcttgctgcaatcaaatcacaaaatggtgctgcaatgtcattcggtcgtacc
gcaacctttattgacgtgtacatcgaacgtgatttaaaagcaggaaaaattactgaaact
gaagcgcaagaattagttgaccacttagttatgaaacttcgtatggttcgtttcttacgt
acacctgaatacgatcaattattctctggtgacccaatgtgggcaactgaaaccatcgct
ggtatgggtttagatggtcgtacattagtaaccaaaaatacattccgtattttacacact
ctttacaacatgggtacttctccagaaccaaacttaaccattctttggtctgaacaatta
cctgaaaacttcaaacgtttctgtgcaaaagtatcgattgatacctcatcagttcaatac
gaaaacgatgatttaatgcgtccagacttcaacaacgatgactacgcaatcgcatgttgt
gtatcaccaatgattgtgggtaaacaaatgcaattcttcggtgcacgtgcaaacttagcg
aaaacattgttatacgcaatcaacggcggtattgatgaaaaattaggtatgcaagtaggc
ccgaaaactgcaccaattactgatgaagtattagattttgatacagtaatgactcgtatg
gatagtttcatggattggttggcaaaacaatatgtgactgccttaaacgtaatccactat
atgcacgataaatattcatacgaagccgcattaatggcattacatgatcgtgatgtatac
cgtactatggcttgtggtatcgctggtctttctgttgcggctgactcactttcagcaatc
aaatatgcgaaagttaaaccagttcgtggcgatatcaaagataaagatggcaatgttgtt
gcaactaacgtagcaatcgactttgaaatcgaaggtgaatatccacaatatggtaacaat
gataaccgtgttgatgacatcgcttgtgacttagttgaacgtttcatgaagaaaattcaa
aaacttaaaacttaccgcaatgctgtacctacacaatctgtattaaccattacttctaac
gtagtttatggtaagaaaacgggcaacaccccagatggccgtcgtgctggtgcaccattc
ggaccaggtgcgaacccaatgcacggtcgtgaccaaaaaggtgcggtagcatcattaact
tctgtagctaaacttccatttgcttatgcgaaagatggtatttcttataccttctcaatc
gtaccaaatgcgttaggtaaagatgccgaagcacaacgccgtaatcttgctggtttaatg
gatggttacttccaccacgaagcaacagttgaaggtggccaacacttaaatgtgaacgtg
ttaaaccgtgaaatgttattagatgcaatggaaaatccggataaatatccacaattgact
atccgtgtatctggttacgcagtacgtttcaactctttaactaaagagcaacaacaagac
gtaattactagaactttcacagagtcaatgtaa

DBGET integrated database retrieval system