KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05235Help
Entry
CGSHiEE_05235     CDS       T00543                                 

Definition
(GenBank) DNA topoisomerase IV subunit A
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_05235
Enzymes [BR:hip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     CGSHiEE_05235
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  ribosomal protein modification factors
   CGSHiEE_05235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST UPF0147 Dala_Dala_lig_C ATP-grasp_6 R2K_3
Motif
Other DBs
NCBI-ProteinID: ABQ98427
UniProt: A5UCC6
Position
complement(1052809..1053705)
Genome map
AA seq 298 aa AA seqDB search
MLCREPRLYSCQRLKEAAKRQGHEMDILDPNRCLLKLSQNPPHFQIFYQENSGSKPYLLP
DYDAVLPRFGTTSTQMGCSVLQHFEGKGTFCLNSSQAFLNARDKWKSLQLLLKTGVPVPN
SFLSGGEVQAQATIPHISSPTILKMLNGSQGIGVILAEKPQSAVSIMEAFKQTNISMLQQ
DFIEEAGNADIRCFVIGDQVVATMQRIGQDGEFRANCHRGGKTEKIILSDDEKQIAIRAT
KAIGLDVAGVDLIRSKNGLLVLEVNASPGLEMIEKTSGVDIAAEIIDYIEINAFINLR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgctttgccgcgaacctcgtctttatagttgccaacgcttaaaagaagctgctaaacgt
caagggcatgagatggatattttagatccgaatcgttgcctcttaaaactctcacaaaat
ccaccgcactttcagattttttatcaagaaaattcagggtctaaaccttatttattgcct
gattatgatgcagttttgcctcgatttggcacaacaagtacacaaatgggatgctcagtc
ttacagcattttgaaggcaaagggactttttgtttaaattcatctcaggcatttttaaat
gcacgtgataagtggaaaagtttgcaacttttgctgaagactggtgttcctgttcccaat
tcatttttaagtggcggtgaagtgcaagctcaggcgacgatacctcatatcagttcgccg
acaattttaaaaatgctaaatggttcacaaggaattggggtaattttagctgaaaagcca
caaagtgcggtgagcattatggaagcttttaagcaaactaatatatctatgttgcagcaa
gattttattgaagaagcgggcaatgcggatattcgttgttttgtgattggtgatcaagtt
gtagcaacgatgcaacgaatcggacaagatggcgagtttcgagcgaattgtcatcgtggt
ggaaaaactgaaaaaattatactaagcgatgacgagaaacagatagccattagagcaaca
aaagccatcggtttagatgtggctggtgtggatttaattcgttcaaaaaatggattattg
gttttagaagtaaatgcaagcccaggcttagaaatgattgaaaaaacaagtggggttgat
attgcagctgaaataattgattatattgaaataaatgcctttatcaatttaagataa

DBGET integrated database retrieval system