KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05670Help
Entry
CGSHiEE_05670     CDS       T00543                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CGSHiEE_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABQ98499
Position
1133678..1134940
Genome map
AA seq 420 aa AA seqDB search
MEIISQYGSWLVWITAAFGFFMAFGIGANDVSNSMGTSVGSGTVTAKQAIIIALIFESAG
AYLAGGEVTQTIKSGVIDPIQFVDTPDILALGMLSTLFASGAWLFIVTKMGWPVSGIHTI
IGAIIGFACITIGPSSVDWSNIGSIVGSWFITPVISGILAYAIFASTQKLIFDTEQPLKN
AQKYGPYYMGITVFVLCIVTMKKGLKHVGLNLSNSETLIISLAISLIGMFFFHFYFKSKI
FTQSANKGTFGAVEKVFSILMLLTACAMAFAHGSNDVANAIGPLSAVVSIVNEGGKIVSG
GALTWWILPLGALGIAVGLITMGQKVMATVGSGITDLTPSRGFAAQFATAMTVVVASGTG
LPISTTQTLVGAILGIGFARGIAALNLTVIRNIISSWIVTLPAGAFFAIIIFYVLRTIFN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaattattagtcaatatggttcttggttggtgtggatcacagcagcctttggcttt
tttatggcgttcggaattggagcaaatgatgtctcaaactcaatgggtacatccgtagga
tctggtactgtaacagccaaacaagcaattattattgcgttaatttttgaatctgcaggt
gcatatttagctggtggcgaagtaacacaaaccataaaaagtggcgtaatcgacccaata
caatttgttgatacacccgatattttagccttaggtatgctttcaaccttatttgcatca
ggtgcttggttatttattgtaaccaaaatgggttggccagtttctggtatacacactatt
attggtgcaattattggatttgcctgtattacgattggccctagttctgtagattggtca
aatattggcagcatcgttggtagctggtttatcacgcctgtcatctcgggtattttggct
tatgcaatctttgcaagtacgcaaaaacttatttttgatactgaacagccattaaaaaat
gcacaaaaatatggcccttattatatggggataaccgtgtttgtactttgtatcgtgacg
atgaaaaaaggcttaaaacacgtaggcttaaatctttcaaacagtgaaactttaatcatt
tcacttgctatcagtcttatcggaatgtttttcttccatttctattttaaaagcaaaatc
ttcactcaatcagcaaacaaaggcacttttggtgccgtagaaaaagtcttcagtatttta
atgttattaaccgcttgtgcgatggcatttgcgcacggttctaatgacgtagccaatgca
attggccctctttctgcagtggtctctattgtaaatgaaggcggtaaaattgtttcaggt
ggagccttaacttggtggattttacccttaggtgcattaggtattgctgtgggcttaatt
actatgggacaaaaagtgatggcgactgttggatctgggatcaccgatttaacgccaagc
cgtggctttgctgctcaatttgctactgcaatgactgttgtagttgcatcaggcacaggc
ttacccatctcaacaacacaaacacttgttggagctattttaggtatcggttttgcacgt
ggtatcgctgcactgaatttaacggttatccgaaacatcattagttcttggattgtcaca
ttaccagcaggcgcatttttcgccattattattttctatgtgctaagaactatctttaat
taa

DBGET integrated database retrieval system