KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05720Help
Entry
CGSHiEE_05720     CDS       T00543                                 

Definition
(GenBank) riboflavin synthase subunit alpha
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00740  Riboflavin metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CGSHiEE_05720
Enzymes [BR:hip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     CGSHiEE_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-ProteinID: ABQ98507
Position
1143086..1143700
Genome map
AA seq 204 aa AA seqDB search
MFTGIVQGTAPIHSIKETANFRTQVVKLLPEMRKDLEIGASIANNGVCLTVTEINGDLVS
FDLMQETLKITNLGTIKVGDYVNIERAMQMGTEIGGHLLSGHIYCTAKISDIIASENNRQ
IWFELPNADVMKYILTKGFVAVDGISLTIGEVKGTQFCVNLIPETLQRTLMGQRKVGDIV
NIEIDPQTQAIVDTVENYLQSKNF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttactggaattgtacaaggcaccgcccccatccactccattaaagaaacggctaat
tttagaacacaagtggtaaaattactacctgaaatgcgtaaagatctggaaattggcgca
tcaatagcaaataacggtgtatgtttaactgtaactgaaatcaatggcgatctggttagc
tttgatctgatgcaagaaactttaaaaattacaaatctcggcacaataaaagtgggcgat
tatgtgaatatcgaacgtgctatgcaaatgggaacggaaattggcggacatttattatct
ggtcatatttattgcaccgcaaaaatttcagatattatcgctagtgaaaataaccgacaa
atttggttcgagctcccaaacgcagatgtaatgaaatacattttaacgaaaggatttgtt
gcggtagatggtattagcctcactattggtgaagtaaaaggcacgcaattctgtgtgaat
ttaatccctgaaaccttgcaaagaacgttaatggggcaacgtaaagtgggcgatattgtg
aatattgaaatcgatcctcaaacgcaagctattgtagatactgtagaaaattatttgcag
tcaaaaaatttttag

DBGET integrated database retrieval system