KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05725Help
Entry
CGSHiEE_05725     CDS       T00543                                 

Definition
(GenBank) aminopeptidase N
  KO
K01256  aminopeptidase N [EC:3.4.11.2]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00480  Glutathione metabolism
hip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CGSHiEE_05725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hip01002]
    CGSHiEE_05725
Enzymes [BR:hip01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     CGSHiEE_05725
Peptidases [BR:hip01002]
 Metallo Peptidases
  Family M1
   CGSHiEE_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3458_C Peptidase_M1 DUF3458 DUF2268 Peptidase_M61
Motif
Other DBs
NCBI-ProteinID: ABQ98508
Position
complement(1143772..1146381)
Genome map
AA seq 869 aa AA seqDB search
MLAKAKYRKDYKQLDFTVTDIYLDFQLDPKHTVVTASTKFQRLNDEATSLRLDGHSFQFS
SIKFNGEPFSAYQQDGESLTLDLKGKSAEEFELEIVTFLVPAENTSLQGLYQSGEGICTQ
CEAEGFRQITYMLDRPDVLACYTTKITADKSKYPFLLSNGNRIASGELEDGRHWVEWNDP
FPKPSYLFALVAGDFDLLQDKFITKSGREVALELYVDRGNLNRATWAMESLKKAMKWDED
RFNLEYDLDIYMIVAVDFFNMGAMENKGLNIFNSKFVLANPQTATDEDYLAIESVIAHEY
FHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDTGSRAVNRINNVKFLRTVQFAEDASP
MSHPIRPEKVIEMNNFYTVTVYEKGAEVIRMLHTLLGEQGFQKGMQLYIAENDGKAATCE
DFVSAMERANNLDLNQFRRWYSQSGTPELLISDAYDEKTHTYRLTVSQSTPPTADQMEKV
NLHIPLKIALYDANGTKQMLQHNGELLSDVLNVTEKDQVFEFHGIYGRPIPALLCDFSAP
VKLDYDYKTEQLLGLLKFADNQFIRWDAAQMLFAQELRRNVVRFQQGEALEISPEILTAL
SYVLNNYEKDIELATLILTLPKEMEFAEGFKTIDPDGISVARAFMQAQIAESLKDDFLRV
YTHIRLDDYQVTQQDIALRAMRNLCLTYLAYTNLGNNLVQKHYNNANNMTDTLAALSVAT
KAALPCRDALLADFEQKWQQDGLVMDKWFALQATRPDENVLEIIQLLMDHPSFNFNNPNR
LRSLVGSFANHNLKAFHNVSGSGYRFLTDVLIRLNESNPQVAARLIEPLIRFSRFDAQRQ
TLMKRALERLSVVENLSKDLFEKIEKALQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttagccaaagcaaaatatagaaaagattacaaacaactagattttacggtcacagac
atttatttagattttcaacttgatcctaaacatactgtggtaaccgcaagcacaaaattc
caacgcttaaatgatgaagcgacttctttacgtttagacgggcatagcttccagttttct
tctattaaatttaatggcgagccattttctgcttatcaacaagatggcgagagtttaacg
ctcgatttgaaaggcaaaagtgcggaagaatttgaacttgaaattgtgactttccttgtg
ccagctgaaaatacttcattacaaggattgtatcagtctggcgagggtatttgtacgcaa
tgtgaggcggaaggtttccgtcaaatcacttatatgcttgaccgtccagatgtattggcg
tgctatacaaccaaaattacggcggacaaaagcaaatatccattcttactttctaatggc
aatcgcattgcaagtggcgaattagaagatggtcgtcattgggtggaatggaatgaccca
ttcccaaaaccaagctatttatttgctttagtggcaggggattttgatttattacaagat
aaatttattactaaaagtggccgtgaagttgcgttagagctttatgtggatcgcggtaat
cttaaccgtgcaacttgggcaatggaaagtttgaaaaaagcgatgaaatgggatgaagat
cgctttaatttagaatacgacttagatatttatatgatcgtcgctgtcgattttttcaat
atgggtgcaatggaaaacaaagggttgaatatttttaattctaaatttgtattagccaat
ccacaaacggcaacagatgaggattatcttgctattgaaagtgtgattgcacacgaatat
ttccataactggacaggcaatcgtgtgacttgccgtgattggttccaattaagtttgaaa
gaaggcttaacggttttccgtgatcaagaattttcttcagatacaggttcgcgtgcagtg
aatcgcattaataatgtgaaatttttacgcactgtgcaatttgccgaagatgcaagccca
atgtcacacccaattcgccctgaaaaagtgattgaaatgaataatttttataccgtaacc
gtatatgaaaaaggggcagaagtgattcgtatgttgcataccttattaggtgaacaaggc
ttccaaaaagggatgcagctttatattgctgaaaatgatggcaaagcggcaacctgtgaa
gattttgtttctgcgatggaacgtgcaaataacctcgatttaaaccagttccgccgttgg
tatagccaatcgggtacaccagaattattgattagcgatgcttatgacgaaaaaacgcat
acttatcgtttaacggtttcacaatccacaccgccaaccgcagatcaaatggaaaaagtg
aatttacatattccattaaaaatcgcgctttatgatgcgaatggcacgaaacaaatgtta
caacataatggcgaattgttgagtgatgtattaaatgtcactgaaaaagaccaagtcttt
gaatttcacggcatttatggtcgcccaattccagcattattatgtgatttttctgcgcca
gtaaaactggattatgattataaaacggaacagttattaggcttgctgaaatttgcagac
aatcaatttatccgttgggatgcagcacaaatgctatttgcgcaagaattacgtcgtaat
gttgtgcgtttccaacaaggcgaggcactagaaatttcgcctgaaattttgaccgcactt
tcttatgttctgaataattacgagaaagatattgaactggcaacattaattctcacactg
ccgaaagaaatggaatttgcggaaggtttcaaaactatcgatcctgatggtatttcagtc
gcaagagcatttatgcaagcgcaaattgcagaatcgttaaaagatgatttcttgcgtgtt
tatacccatattcgtcttgatgattatcaagttacgcaacaagacatcgccttgcgtgca
atgcgtaatctttgcttaacttatttggcttatacgaatttgggtaacaacttagtgcaa
aaacactataataatgcgaataatatgacagatacattggcagcattaagtgttgcaact
aaagctgcattaccttgcagagatgcgttattagctgattttgaacaaaaatggcaacag
gatggattagtgatggataaatggtttgcattacaagccactcgcccagatgaaaatgtg
ttggaaattattcagttattaatggatcacccaagttttaattttaataatccaaaccgt
ttacgttcattagtgggtagttttgcaaatcacaatttaaaagcatttcacaacgtaagc
ggttctggctatcgtttcttaacggatgtgttaatccgtttaaatgaaagtaatccacaa
gtggctgcgcgtttaatcgagccattaattcgattttctcgctttgatgctcaacgccaa
acgctgatgaaacgtgctttagaacgcctaagcgttgtagaaaatctttcaaaagattta
tttgaaaaaattgagaaagcgttgcagtaa

DBGET integrated database retrieval system