KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05750Help
Entry
CGSHiEE_05750     CDS       T00543                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00220  Arginine biosynthesis
hip00250  Alanine, aspartate and glutamate metabolism
hip00270  Cysteine and methionine metabolism
hip00330  Arginine and proline metabolism
hip00350  Tyrosine metabolism
hip00360  Phenylalanine metabolism
hip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hip00401  Novobiocin biosynthesis
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
hip01210  2-Oxocarboxylic acid metabolism
hip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CGSHiEE_05750
   00270 Cysteine and methionine metabolism
    CGSHiEE_05750
   00220 Arginine biosynthesis
    CGSHiEE_05750
   00330 Arginine and proline metabolism
    CGSHiEE_05750
   00350 Tyrosine metabolism
    CGSHiEE_05750
   00360 Phenylalanine metabolism
    CGSHiEE_05750
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_05750
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CGSHiEE_05750
Enzymes [BR:hip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CGSHiEE_05750
Amino acid related enzymes [BR:hip01007]
 Aminotransferase (transaminase)
  Class I
   CGSHiEE_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABQ98513
Position
1148976..1150166
Genome map
AA seq 396 aa AA seqDB search
MFEHIKAAPADPILGLGEAFKSETRENKINLGIGVYKDAQGTTPIMRAVKEAEKRLFDKE
KTKNYLTIDGIADYNEQTKALLFGKDSEVIKSNRARTVQSLGGTGALRIAAEFIKRQTKA
QNVWISTPTWPNHNAIFNAVGMTIREYRYYDAERKALDWDHLLEDLSQASEGDVVLLHGC
CHNPTGIDPTPEQWQELAALSAKNGWLPLFDFAYQGLANGLDEDAYGLRAFAANHKELLV
ASSFSKNFGLYNERVGAFTLVAENAEIASTALTQVKSIIRTLYSNPASHGGATVATVLND
TQLRQEWENELTEMRERIKKMRHLFVQLLKEYGAEQDFSFIIEQNGMFSFSGLTGEQVDR
LKEEFAIYAVRSGRINVAGITEDNIRYLCESIVKVL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacatattaaagcggcaccagccgatccaatcttaggcttaggcgaagcattc
aaatccgaaactcgcgaaaataaaattaacttgggtattggcgtttataaagatgcgcaa
ggcacaaccccgattatgcgtgcagtgaaagaagcagaaaaacgcttatttgataaggaa
aaaacgaaaaattatctgactatcgatggtattgctgattataacgaacaaacaaaagcg
ttacttttcggtaaagattctgaagtcatcaaatctaatcgtgcaagaacagtacaaagt
ttaggcggaacaggcgcattacgcattgcggcagaatttattaaacgtcaaactaaagca
caaaatgtttggatcagcaccccaacttggccaaaccacaatgccattttcaatgccgtc
ggtatgacaattcgtgaatatcgttattatgatgctgaacgcaaagcccttgattgggat
catttacttgaagatttaagccaagcaagcgaaggcgatgtggtgcttttacacggttgt
tgccataatccgactggtattgaccctactccagaacaatggcaagaattagccgcactt
tcggcgaaaaacggctggttgccactctttgactttgcttatcaaggtttagccaatgga
ttagatgaagatgcttatggcttgcgtgcttttgcggcaaaccacaaagaattgttagta
gcgagttcattctcgaaaaactttggtttatataatgaacgtgttggtgcctttactctt
gtggcagaaaatgcagaaattgcatcaaccgcattaacccaagtgaaatcaattattcgt
acactctactctaaccctgcatctcacggcggcgcaactgtagcaacagtattaaatgac
actcaacttcgccaagagtgggaaaatgaattaactgaaatgcgcgaacgtatcaaaaaa
atgcgtcatttattcgttcagttattaaaagaatacggtgcggaacaagatttcagcttt
atcattgaacaaaacggtatgttctctttcagtggattaactggggaacaagtggatcgc
ttaaaagaagaatttgccatttatgctgttcgttctggtcgtatcaatgtggctggtatt
actgaagataatattcgctatttatgtgaaagcattgtgaaagtgctttaa

DBGET integrated database retrieval system