KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05765Help
Entry
CGSHiEE_05765     CDS       T00543                                 

Definition
(GenBank) cobalt transport protein CbiM
  KO
K02007  cobalt/nickel transport system permease protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02010  ABC transporters
Module
hip_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGSHiEE_05765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_05765
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    CGSHiEE_05765
   Nickel transporter [MD:M00246] [OT]
    CGSHiEE_05765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiM
Motif
Other DBs
NCBI-ProteinID: ABQ98516
Position
complement(1151533..1152153)
Genome map
AA seq 206 aa AA seqDB search
MHLSEGVLHTPILLAGAVLAVAGIAVGVRRLESERLPLTALFAAAFFVAGTIHVPVGIGS
VHLILNGMAGLFLGWAVFPAFLIALLLQVIFFSFGGFAVLGVNLCVMAIPAVIAYYLFRS
RLQPQMALKDRLLVGIGAGVIGVGGAGVLASFVLMLDGGKSYLNLVWLLLVSHIPVFVLD
SIISVGVITLLGKMYPEVMNRTENFS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcatttatctgaaggcgtgttacatacgcctattttattagctggtgcagtgcttgct
gttgcgggcattgctgtgggggtacgtcgtttagaatcagaacgtttaccgctcaccgca
ctttttgccgctgcattttttgtggcaggaaccattcatgtgcctgtaggaattggtagc
gtgcatttaattttaaatggcatggctggtttatttcttgggtgggccgtttttccagca
ttcctcatcgcacttttattgcaagtcattttcttttcttttggtggatttgccgtgtta
ggtgtcaatctttgcgtgatggcaataccagctgtgatcgcttattatcttttccgttct
cgtttacagccacaaatggcattaaaagatcgcttattagtcggtattggtgctggcgta
attggcgttggcggagcaggcgtgcttgcttcttttgtgctgatgttagatggtggtaaa
agttatctgaatcttgtttggctcttgctagtctctcatattccagtatttgttttggat
agtattatcagcgtaggggtgattaccttgcttggtaaaatgtatcctgaagtcatgaat
cgtaccgagaatttctcttaa

DBGET integrated database retrieval system