KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05850Help
Entry
CGSHiEE_05850     CDS       T00543                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00620  Pyruvate metabolism
hip00680  Methane metabolism
hip01100  Metabolic pathways
hip01120  Microbial metabolism in diverse environments
hip01200  Carbon metabolism
Module
hip_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGSHiEE_05850
  09102 Energy metabolism
   00680 Methane metabolism
    CGSHiEE_05850
Enzymes [BR:hip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CGSHiEE_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ANAPC4
Motif
Other DBs
NCBI-ProteinID: ABQ98531
UniProt: A5UCN0
Position
1162256..1164895
Genome map
AA seq 879 aa AA seqDB search
MTQEYSTLRNNISMLGRFLGETINDAQGEDILELIENIRKLSRNSRAGDDKARQALLDTL
GSISNENIIPVARAFSQFLNLTNIAEQYQTISREHSLAQSSSQSLSELFKRLKEQNASVE
EVHKTVEKLLIELVLTAHPTETTRRSLIHKHIEINKCLSKLEHHDLTEKERNIIERLLLR
LIAEAWHTNEIRTVRPTPFDEAKWGFAMLENSLWQAVPEFLRQLNETAREFLGYDLPVGL
KPVRISSWMGGDRDGNPFVTAQITKKVLYFARWKAADLFLQDISKLADELSMMKCSDEFR
DKYGEHLEPYRFVVKNLRNQLTATLAYFDDHLSNRTPRVSESEIILEDNQLWEPLYDCYQ
SLIQYGMRIIANGSLLNILHRISCFGVTLSQMDIRQESTRHTDAIAEITRYIGLGDYAQW
TEDDKQAFLIRELSSRRPLIPQNWTPSPETQEILDTCKVIAQQKQGVIACYVISMARNAS
DVLAVHLLLKEAGVPYHIPVVPLFETLEDLDAAEKVMTQLFNVGWYRGVINNRQMVMIGY
SDSAKDAGMMAASWAQYRAQEALVNLTEKLGIELTLFHGRGGTIGRGGAPAHAALLSQPP
RSLKNGLRVTEQGEMIRFKLGLPTVAVETFDLYASAILEANLLPPPEPKPEWRNIMDELS
TISCDIYRGVVRGDKDFVPYFRSATPEQELSKLPLGSRPAKRNPNGGVESLRAIPWIFAW
MQNRLMLPAWLGAGASIRQIIEQGKGDIIHKMCENWPFFSTRIGMLEMVFSKSDTWLSQQ
YDQRLVKKELWYLGENLRKQLEDDIQTVLSLSHQSELMSDLPWIADSIALRNIYTDPLNL
LQVELLHRFRENPEQVNPDVEQALMITITGIAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagagtacagtactctgcgcaataacattagtatgttagggcgttttctcgga
gaaaccatcaatgatgcacagggcgaggatattctcgagttaatcgaaaacattcgtaaa
ctttctcgtaattctcgtgctggcgatgataaagcaagacaagcattgctcgatacgctc
ggtagtatttctaatgaaaatattattcccgtcgcacgtgctttcagtcaatttttaaac
ctcactaacatagcagaacaatatcaaaccatttcccgtgaacattctcttgcacaaagt
tcttctcaatccttaagcgaacttttcaaacgcttaaaagaacaaaatgcttcagtggaa
gaggtgcataaaaccgtcgaaaaattattaattgagcttgttctgaccgcacatccaaca
gaaacaacacgtcgttcattaattcataaacacattgaaatcaataaatgtttaagcaag
ctagaacatcatgatttaacggaaaaagaacgcaatattattgaacgtctattacttcgt
ttaatcgctgaagcatggcataccaacgaaattcgtactgttcgcccaacgccatttgat
gaggctaaatggggctttgcgatgttagaaaacagtttgtggcaagctgtgccagaattt
ttacgccaactcaacgaaaccgcccgtgaatttttaggttatgacttgccagtaggatta
aaacctgtgcgtatttcctcttggatgggcggcgaccgtgatggaaatccatttgttacc
gcacaaattaccaaaaaagtactttattttgcgcgctggaaagcggcagatttattctta
caagacatcagcaaattagccgatgaactttcaatgatgaaatgtagcgatgaatttcgt
gataaatacggcgaacatttagaaccctatcgtttcgtagtaaaaaatttacgcaatcaa
cttacagcaacattagcttattttgatgatcacttatctaatcgcacaccaagagtctcc
gaaagcgagattattttggaagataatcaactgtgggagccgctttacgattgttatcaa
tctttaattcaatacggtatgcgcattattgcgaatggttcattgctgaatattttgcac
cgtattagttgctttggcgtgacactttctcagatggatattcgccaagaaagcactcgt
cacaccgatgccattgctgaaatcacgcgctatattggtttgggcgattacgctcaatgg
acggaagacgataaacaggctttcttaattcgggaattaagctcacgccgtccattaatt
ccgcaaaactggacgccatcgcctgaaacccaagaaattttagatacttgcaaagtcatt
gctcaacaaaaacaaggtgtcatagcttgttatgttatttcgatggcacgcaatgcatcc
gatgttttagccgttcatttactcttaaaagaagctggcgtgccatatcatattcctgtt
gtgccattatttgaaaccttggaggatctagatgcagccgaaaaagtcatgactcaactt
ttcaatgtgggttggtatcgtggcgttatcaataatcgtcaaatggtaatgattggttat
tcagattcggcaaaagatgcgggaatgatggctgcctcttgggcgcaatatcgtgcgcaa
gaagccttagtgaatttaacggaaaaacttggtattgaactcactttattccacggacgt
ggtggcacaattggtcgtggcggtgcgccagcacatgcggcattactttctcaaccgcct
cgttccctaaaaaatggtttacgtgtaacagaacaaggcgaaatgattcgcttcaaactg
ggtttacccactgtggcggtagaaacctttgatctctacgccagtgccattttagaagca
aatctgttaccgccaccagaaccgaaaccagaatggcgtaacataatggacgagctttcc
acgatttcttgcgatatttatcgtggtgtggtgcgtggcgataaagatttcgtgccttat
ttccgtagtgcaacgccagaacaggagctgtccaaattgccgcttggatctcgcccagca
aaacgcaatccaaatggcggcgtggaaagtttacgtgccatcccttggatttttgcgtgg
atgcaaaatcgcttaatgctacctgcttggttaggcgcaggtgcctctatacgtcaaatt
atcgaacaaggaaaaggcgatattattcataaaatgtgtgaaaactggccgttcttttca
acgcgaatcggaatgttggaaatggtctttagtaaatcggatacttggctttcccaacaa
tatgatcaacgattagtgaaaaaagaactttggtatttaggggaaaatttacgtaagcaa
cttgaagatgatattcaaactgtactttcactttctcatcaaagtgaattgatgtctgat
ttaccttggattgcagattcaattgcattacgtaatatctacacggatccgctcaatcta
ctacaagtagaattacttcaccgtttccgtgaaaatccagagcaagtaaatcccgatgtg
gaacaagcattgatgattaccatcacaggtatcgcggctgggatgcgcaatacgggctag

DBGET integrated database retrieval system