KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05855Help
Entry
CGSHiEE_05855     CDS       T00543                                 

Definition
(GenBank) transposase
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve
Motif
Other DBs
NCBI-ProteinID: ABQ98532
Position
complement(1165040..1165168)
Genome map
AA seq 42 aa AA seqDB search
MIGYQNILRENDIQQNMSRKGNCLDNSAMEIFWMVKNGMLLW
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgataggctatcaaaacatactaagagagaatgacattcaacaaaatatgtcaaggaag
ggaaattgtttagataacagtgcaatggaaattttttggatggttaaaaacggaatgtta
ttatggtaa

DBGET integrated database retrieval system