KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05865Help
Entry
CGSHiEE_05865     CDS       T00543                                 

Definition
(GenBank) modification methylase
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00270  Cysteine and methionine metabolism
hip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGSHiEE_05865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hip03032]
    CGSHiEE_05865
   03036 Chromosome and associated proteins [BR:hip03036]
    CGSHiEE_05865
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hip02048]
    CGSHiEE_05865
Enzymes [BR:hip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     CGSHiEE_05865
DNA replication proteins [BR:hip03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    CGSHiEE_05865
Chromosome and associated proteins [BR:hip03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CGSHiEE_05865
Prokaryotic defense system [BR:hip02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    CGSHiEE_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase
Motif
Other DBs
NCBI-ProteinID: ABQ98534
Position
1165748..1166977
Genome map
AA seq 409 aa AA seqDB search
MSNLPYKNQENYSLPFSFQYENWRNKPFSNPSSHIRLATVFSGIGAIEQAMKRLKLNHEI
IFAGDIDPHVKKSYLANYQLSEEHWHSDITTFDATPYREQIDLLVGGSPCQAFSMVGKRH
GLEDTRGTLFYDFARVVNETKPKIFIYENVKGLLNHDNGKTWQVVKDVLHALGYDLYFQV
MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEKGIK
FVTSSKNRQKRYTQINGDVMLCQKANQQFNWHGDFIFEYAVNCSKFDEFIFNVNDVEEKY
YLSNKIRDYVLAGGTKNFKTSTETDLTVARPLLQTMHKMHRAGVDNYVTHNQGRIRKLTP
RECLRLMGFRDDFQIVVSDTQAYRQAGNSIVVDVLIAILKQIDITKYGV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatttaccatataaaaatcaagagaattattcccttcctttctcctttcaatat
gaaaactggcggaataaacctttttcaaatcccagttctcatattcgtttagcaactgtt
tttagcggcatcggtgcgattgaacaggctatgaaacgtttgaaattaaatcatgaaatt
atatttgctggagatattgaccctcatgtaaaaaaaagttatttagcaaattatcaatta
tcagaagagcactggcattctgacattacaacctttgatgcgacgccttaccgagaacaa
atagatttattagttggtggaagcccttgtcaagcgttctccatggtaggtaaaaggcat
ggtttggaggatactcgtggtactttattctatgattttgcccgtgtagtcaatgaaaca
aagccaaaaatttttatttatgaaaacgtaaagggattattgaatcatgataatggcaaa
acatggcaggtagtaaaagatgtattacatgcactaggttatgatttatattttcaagta
atgaacagcaaaaattatggtataccacaacatcgtgagcgtattttcgtggttggtttt
aaaactcctccccaagggggatttatgtttccagcagaaattcctcttgagcattcaatg
caagatttcctagaagattacacagatagcaaatattacctaaaagaaaaaggaattaaa
ttcgtaactagctctaaaaatcgccaaaaacggtacactcaaataaacggtgatgtaatg
ctatgccaaaaagccaatcaacaatttaactggcacggggatttcatatttgaatatgct
gttaattgtagtaaatttgatgagtttatttttaatgtaaatgatgtagaagaaaaatat
tatttatcaaataaaatccgcgattatgttttagctggtggtacaaagaattttaaaact
agtacagaaaccgacttaactgttgcaagaccattattacaaacaatgcataaaatgcat
cgcgctggtgttgataattatgttactcataatcaaggtcgcattaggaaattaacacca
agagaatgcctccgacttatgggctttagagatgatttccaaattgttgtaagtgataca
caagcataccgtcaagcaggaaatagtatcgttgttgatgttttaattgctattttgaaa
caaattgatattacaaaatatggagtataa

DBGET integrated database retrieval system