KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05870Help
Entry
CGSHiEE_05870     CDS       T00543                                 

Definition
(GenBank) putative type II restriction endonuclease
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH_2
Motif
Other DBs
NCBI-ProteinID: ABQ98535
Position
1166980..1167963
Genome map
AA seq 327 aa AA seqDB search
MLIDGITYFPIDTKEKITIADSFVVRANKIGHGNGEAKLYIGNENEENRSFFGENGFIVR
CFLLKQDLIKYLDETKEEYLSPEQLYQNASELPTLWLERRQKITKLPEIIWFDIEEQTQI
AGPRLYVKFNNKQSKFGYELIRELSLPNVTYISIVKLVNSKTLKEPIFYIRLFADYFGDV
IHPAILEQEEKNILGEPDSREKTEKLRARQGQGEYRKKLLEQCPFCPITLISDDRLLIAS
HIKPWAKSNDFEKTDPYNGFMFTPTIDHLFDRGFITFTDNQEMLLSPFLSKMTYSKLGLS
DRKKYPMLKIEGRTGYLEYHRQEIWKG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgatggaattacttattttcctatagatactaaagaaaagattactattgcg
gattcatttgtcgttagagctaataaaataggtcatggaaatggagaggcaaaattatat
atcggcaatgaaaatgaggaaaatagatcattttttggggagaatggattcatagttcgt
tgttttttactaaagcaggatttaattaaatacttagatgagacgaaagaggaatattta
tctccagaacagctttatcaaaatgctagtgaactccctacattgtggttagagcgccga
caaaagattaccaagctgcctgaaataatttggtttgatatagaagaacaaacacaaatt
gcaggcccaagattgtatgttaaatttaataataaacaatcaaaatttggatatgaactt
atccgagaactttccttacctaatgtgacatatatttctatcgtaaaactagttaactca
aaaactctaaaagaacctattttttatattcgtctctttgcagattatttcggtgatgtt
atccaccctgctattcttgaacaagaagaaaaaaatatcctaggagaacctgatagtcgt
gaaaaaacagaaaaattaagagcacggcaaggtcagggagaatataggaaaaaactgtta
gaacaatgtccattttgtccaattacattgatttctgatgatcgccttttaatcgcaagt
catattaaaccatgggcaaaatcaaatgactttgagaaaacagatccatataacggattt
atgtttacaccaaccatagatcatctatttgatcgtggtttcattaccttcacagataat
caagaaatgctactctctccttttctatccaaaatgacttattcaaaattaggattaagc
gacagaaaaaaatatccaatgttaaagattgaagggagaacaggatatttagaatatcat
agacaggaaatttggaagggttga

DBGET integrated database retrieval system