KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05880Help
Entry
CGSHiEE_05880     CDS       T00543                                 

Definition
(GenBank) ABC-type transport system, periplasmic component, involved in antimicrobial peptide resistance
  KO
K19226  cationic peptide transport system substrate-binding protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip01503  Cationic antimicrobial peptide (CAMP) resistance
hip02010  ABC transporters
Module
hip_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGSHiEE_05880
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CGSHiEE_05880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_05880
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    CGSHiEE_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ABQ98537
Position
1169489..1171183
Genome map
AA seq 564 aa AA seqDB search
MLRLNLRFLSFLLCISQSVELQAAPSVPTFLTENGLTYCTHASGFSFNPQTADAGTSMNV
VTEQIYNKLFDIKNHSATLTPMLAQSYSISADGKEILLNLRHGVKFHQTPWFTPTRDFNA
EDVVFSINRVLGHNTYLPTLAEANVTYSNPQYRVFHEQARKVRFPYFDSIKLNEKIKSVT
ALSPYQVKIELFAPDSSILSHLASQYAIIFSQEYAYQLSADDNLAQLDTHPVGTGPYQVK
DYVYNQYVRLVRNENYWKKEAKIEHIIVDLSTDRSGRLVKFFNNECQIASYPEVSQIGLL
KNDDKHYYMQSTDGMNLAYLAFNFDKPLMRDHEIRAAISQSLNRARIIHSIYHNTATVAN
NIIPEVSWASSVNTPEFEFDYNPKIAKNKLADKNLLLNLWVINEEQVYNPAPFKIAEMIK
WDLAQAGVKVKVRAVTRPFLTAQLRNQSENYDLILSGWLAGNLDPDGFMRPILSCGTKNE
LTNLSNWCNEEFDQFMDRAITTSHLSSRAKAYNEAQELVLRELPIIPIANVKRILVANSR
VKGVKMTPFGSLDFSTLYFIQEKH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtctaaatctgagatttttatcttttctgctctgtataagccaaagtgtagaa
ttacaggctgcgccaagtgttccaacatttttaactgaaaatggcttaacttattgcacc
cacgcttcaggtttttcatttaatccgcaaacagcagatgcaggaaccagtatgaatgtg
gtcacggaacaaatttataacaaattatttgatataaaaaatcacagtgcaacattaaca
ccaatgctggcacaatcttattccatttcagctgatggtaaagaaattttattaaattta
cgtcacggcgtaaaatttcaccaaaccccttggtttaccccaacacgtgattttaacgct
gaagacgtagtattttcgattaatcgtgtattagggcataatacttatttaccaacctta
gcagaggcgaatgttacctatagtaatccacaatatagagtgtttcacgaacaagcaaga
aaagtgcgttttccttattttgatagcattaaacttaacgaaaaaatcaaatctgtgacc
gcactttcgccttatcaagtaaaaattgaattatttgcaccagattcctccattttgtcg
catcttgccagccagtatgccattattttttcacaagaatatgcctatcaattaagcgca
gatgacaaccttgctcaattagatacccacccagtaggcacagggccttatcaagtaaaa
gattatgtatataaccaatatgttcgcttagtgcgtaacgaaaactattggaaaaaagaa
gccaagatagaacatattattgtggatctttctactgatcgcagcggacgtttagtcaaa
tttttcaataatgaatgtcaaatcgcctcttatcctgaagtaagccaaattggcttatta
aaaaatgatgacaaacattattatatgcaatctactgatggtatgaatttagcctattta
gcgtttaattttgataagccattaatgcgagatcacgaaatccgtgccgctatttcacaa
agtttaaaccgagctcgaatcattcatagcatttaccataacacagcaactgttgctaat
aacattattcctgaagtatcttgggcttcaagtgtcaatacgccagaatttgagtttgat
tacaatcccaaaatcgccaaaaataaattagcagataaaaaccttttgttaaatttatgg
gtaattaatgaagaacaagtctataatcctgcaccttttaaaatagctgaaatgataaaa
tgggatttagctcaagcgggtgtgaaagttaaagtgcgtgccgtaactcgtccattttta
actgcacaattacgcaatcaatcggaaaattatgatttgattctatctggttggttagct
ggtaatcttgatcctgatggttttatgcgtccaattttaagctgtggaacaaaaaatgaa
ctcactaatttatctaattggtgtaatgaagaatttgatcaatttatggatcgcgccatt
accacctcacatttaagttcacgcgcaaaagcctataatgaagcccaagaactcgtttta
cgtgaattacccattattcctattgccaatgtaaaacgaattttagtcgcaaatagtcgt
gtgaaaggagtaaaaatgacgccttttggtagcttagatttttccaccttatattttatt
caggagaaacactaa

DBGET integrated database retrieval system