KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05965Help
Entry
CGSHiEE_05965     CDS       T00543                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip03410  Base excision repair
hip03430  Mismatch repair
hip03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hip00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CGSHiEE_05965
   03430 Mismatch repair
    CGSHiEE_05965
   03440 Homologous recombination
    CGSHiEE_05965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hip03400]
    CGSHiEE_05965
Enzymes [BR:hip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CGSHiEE_05965
DNA repair and recombination proteins [BR:hip03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     CGSHiEE_05965
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CGSHiEE_05965
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CGSHiEE_05965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 DHH
Motif
Other DBs
NCBI-ProteinID: ABQ98548
Position
complement(1184710..1186305)
Genome map
AA seq 531 aa AA seqDB search
MKKLIKRREIPIGNSVSTHPLLDRLYRARRIQNTKELDRTLKSMLNPNQLYGIDQAVNLL
VEAYQQQQKIVIVGDFDADGATSTALSVLALRQLGFSDVDYLVPNRFEQGYGLSIPVAEM
AIEKGVQLLMTVDNGVSSFEGIAFLKEKGIRVLVTDHHLPPETLPPADAIVNPNLSQCHF
PSKSLAGVGVAFYLMLAVRAKFRELGIFTAETQPNFTDLLDLVALGTVADVVPLDQNNRI
LAYQGLMRIRARRCRPGIIALAEVANRNVEQFTSSDLGFCIGPRLNAAGRLDNMSIGVEL
LLANEMSKARELALDLDELNQMRKEIEAGMKLEAIKICQNLTALFKELPYGITLYQPDWH
QGVLGIVSSRIKDQYHRPVIAFAQDSEGILKGSARSIEGLHMRDVLERIHSQHPNMILKF
GGHAMAAGLSIREEHFADFQHLFNQTVADWLDEEHLQGVIWTDGELNSNEFNLETAELIK
SVGTWGQGFPEPCFDGEFKILDQRAIGQNKNTSKNVARAETRRGFIRCDCI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacttatcaaacgccgtgaaattccaattggaaattctgtttcaacccatccg
ttattagatcgcctttatcgcgctcgtcgtattcaaaacaccaaagaattagaccgcact
ttgaaatcaatgctcaatccaaatcaattatatggcattgatcaagcggtaaatttatta
gtggaggcttaccaacaacagcaaaaaatagtgattgttggggattttgatgcagatggt
gcaaccagcacagcattgagtgtgcttgctttaagacaacttggtttttccgatgtagat
taccttgtgccaaatcgatttgaacaaggttatggtttgagtattcctgtggctgaaatg
gcgattgaaaagggcgttcagttattaatgacggtggataacggcgtttcatcttttgaa
ggcattgcatttttgaaagaaaaaggcattcgagttttagtcacggatcatcatttaccg
cccgaaactttgccgccagccgatgcgattgttaatcctaatttaagtcagtgtcatttc
ccttcaaaatctttagcaggcgttggtgtggcattttatttgatgctggcggtgcgcgca
aaatttcgtgagctcggtatttttactgcagaaacacaacctaattttactgatttgctc
gatctagttgcattgggtactgtcgctgatgttgtgcctttagatcaaaataatcgtatc
cttgcttatcaaggtttaatgcggattcgtgcacggcgttgtcgtcctggtattattgcg
ttggcagaagtggctaaccgtaatgttgaacagtttacttcaagtgatctcggtttttgt
atcgggcctcgtttaaatgcggcagggcgtttagataatatgtcgattggggtggagctt
ttgctggcgaacgaaatgtcaaaagccagagaattagctttagatctcgacgaactcaat
caaatgcgtaaagaaattgaagcgggtatgaaacttgaggcaataaaaatttgtcaaaat
cttaccgcactttttaaagagttaccctatggtattacgctttatcagcccgattggcat
caaggcgtattaggcattgtgtcatcaaggattaaggatcaatatcatcgtccagtgatt
gcctttgcacaagatagtgagggaattttgaaaggttccgcgcgttctattgaaggttta
catatgcgtgatgttctggagcgtattcattcgcaacatcctaatatgattttaaaattt
ggcggacacgcaatggcggcaggcttgagtattcgcgaagaacattttgcggattttcaa
catctttttaatcaaaccgttgccgattggcttgatgaagaacatctacaaggcgtaatt
tggacagatggcgaactgaattcaaatgaatttaatcttgaaacggcagagctgataaaa
tcggtaggcacttgggggcaagggtttcctgagccttgctttgatggcgaatttaaaatt
ttagaccagcgcgcaattggacaaaataaaaatacatctaaaaatgttgctagagccgaa
acaaggcggggttttattagatgcgattgcatttaa

DBGET integrated database retrieval system