KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05975Help
Entry
CGSHiEE_05975     CDS       T00543                                 

Definition
(GenBank) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K02836  peptide chain release factor 2
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
Translation factors [BR:hip03012]
 Prokaryotic Type
  Release factors
   CGSHiEE_05975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RF-1 PCRF MIR
Motif
Other DBs
NCBI-ProteinID: ABQ98550
Position
1187764..1188510
Genome map
AA seq 248 aa AA seqDB search
MFSGKHDACDCYVDLQAGSGGTEAQDWTEMLLRMYLRWAESKGFKTELMEVSDGDVAGLK
SATIKVSGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFSAAFVYPEIDDDIDIEINPA
DLRIDVYRASGAGGQHVNKTESAVRITHMPSGIVVQCQNDRSQHKNKDQAMKQLKAKLYE
LELQKKNADKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDRFI
EASLKAGL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtggcaaacatgatgcttgcgattgctatgtagacttacaagctggttctggc
ggtacggaagctcaagattggacagaaatgttgctgcgtatgtatcttcgttgggcagaa
agcaaaggctttaaaacagaactaatggaagtctctgacggcgatgtagcaggattgaaa
tcggcaaccattaaagtgagcggtgaatatgcctttggttggttacgaacagaaacgggc
attcatcgtttagtgcgtaaaagtccatttgattccaataaccgtcgtcacacatcattc
agtgcagcatttgtctatcctgaaattgatgacgatattgatattgaaatcaatcctgct
gatttacgtattgatgtttatcgtgcatcaggggcaggtggtcagcacgtaaacaaaact
gaaagtgcggtgcgaattacccatatgccaagtggtattgtagtgcaatgtcaaaacgac
cgttcacagcacaaaaacaaagatcaagcgatgaaacaattaaaagcaaaattgtatgag
cttgagttacagaagaaaaatgcggataagcaagcaatggaagataataaatccgacatt
ggttggggaagccaaattcgctcttacgtattagacgattcacgcattaaagatttacgt
actggcgtagaaaaccgtaatacgcaagccgtattagacggggatttagatcgatttatt
gaagcgagtttaaaagcggggctttaa

DBGET integrated database retrieval system