KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05985Help
Entry
CGSHiEE_05985     CDS       T00543                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00020  Citrate cycle (TCA cycle)
hip00270  Cysteine and methionine metabolism
hip00620  Pyruvate metabolism
hip00630  Glyoxylate and dicarboxylate metabolism
hip00680  Methane metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01120  Microbial metabolism in diverse environments
hip01130  Biosynthesis of antibiotics
hip01200  Carbon metabolism
Module
hip_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hip_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGSHiEE_05985
   00620 Pyruvate metabolism
    CGSHiEE_05985
   00630 Glyoxylate and dicarboxylate metabolism
    CGSHiEE_05985
  09102 Energy metabolism
   00680 Methane metabolism
    CGSHiEE_05985
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGSHiEE_05985
Enzymes [BR:hip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CGSHiEE_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ABQ98552
UniProt: A5UCQ1
Structure
PDB: 

Position
complement(1190217..1191152)
Genome map
AA seq 311 aa AA seqDB search
MKVAVLGAAGGIGQALALLLKLQLPAGTDLALYDIAPVTPGVAVDVSHIPTAVNVKGFSG
EDPTPALEGADVVLISAGVARKPGMDRSDLFNINAGIVRGLIEKVAVTCPKACVGIITNP
VNTTVAIAAEVLKKAGVYDKRKLFGVTTLDVLRSETFVAELKGLNVSRTSVPVIGGHSGV
TILPLLSQVQYAKWNEDEIEPLTKRIQNAGTEVVNAKAGGGSATLSMAQAAARFARSLVK
GLSGETVVECTYVEGDGKYARFFSQPVRLGKEGVEEILPIGPLSNFEQQALENMLPTLHA
DIELGEKFING
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctgtattaggtgccgcaggtggtattggtcaagcattagcgttattacta
aaacttcagttgccagcaggcaccgacttagcattgtatgatattgccccagtaacacca
ggtgttgcagtagatgtgagccatattccaacggcagtgaatgtaaaaggtttttctggc
gaagatccaactcctgcacttgagggtgcggatgttgtattaatttctgctggtgttgct
cgtaaacctggtatggatcgttcagatttattcaatattaatgcaggcattgttcgtggt
ttaattgaaaaagtcgcggttacttgtccgaaagcatgcgttggtatcatcactaaccca
gtaaatactactgttgcgattgcggctgaagtgttgaaaaaagcaggtgtttacgacaaa
cgtaaattatttggcgtgacaactttagatgtgttgcgttctgaaacctttgtggctgaa
ttaaaaggtttaaatgtttctcgtacaagcgttcctgttattggtggtcactcaggtgtg
actattcttccattactttctcaagttcaatatgcaaaatggaatgaagatgaaatcgaa
ccattaacaaaacgtatccaaaatgcaggtacagaagtggtcaatgcaaaagcgggtggc
ggttcagcaactctttcaatggcgcaggctgcagcgcgttttgcgcgttctttagtgaaa
ggattaagtggcgagacagtggttgaatgtacttatgttgaaggcgatggtaaatatgct
cgtttcttctctcaaccagttcgtttaggcaaagaaggtgtagaagaaattttaccaatt
ggcccattaagcaattttgaacaacaagccttagaaaatatgttgccgactttacatgca
gatattgaattaggcgaaaaatttattaatggttaa

DBGET integrated database retrieval system