KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06000Help
Entry
CGSHiEE_06000     CDS       T00543                                 

Definition
(GenBank) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00230  Purine metabolism
hip00250  Alanine, aspartate and glutamate metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
Module
hip_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CGSHiEE_06000
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CGSHiEE_06000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hip01002]
    CGSHiEE_06000
Enzymes [BR:hip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     CGSHiEE_06000
Peptidases [BR:hip01002]
 Cysteine Peptidases
  Family C44
   CGSHiEE_06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 PRTase_2
Motif
Other DBs
NCBI-ProteinID: ABQ98555
Position
complement(1192761..1194278)
Genome map
AA seq 505 aa AA seqDB search
MCGIVGIVSQSPVNESIYAALTLLQHRGQDAAGIVTVDDENRFRLRKANGLVSDVFRQEH
MLRLQGNAGLGHVRYPTAGSSSVSEAQPFYVNSPYGVTLVHNGNLTNSVELKEKVFKTAR
RHVNTNSDSELLLNILANHLDHIPQNHLDPQDIFYAVRKTHNDIRGAYACVAMIIGHGMV
AFRDPFGIRPLVLGKREENGKTDYMFASETVALDIVGFEFVRDIAAGEAVYVTFDGELYS
QQCTESAVLNPCIFEYVYFARPDSTIDGVSVYAARVHMGEKLGQKIAKEWADEIDNIDVV
IPIPETSTDIALQIARVLGKPYRQGFVKNRYVGRTFIMPGQAQRISSVRRKLNTIKAEFK
DKNVLLVDDSIVRGTTSEQIVEMARSAGAKKIYFASAAPEIRYPNVYGIDMPSCDELIAY
GRNVDEIAHLIGVDKLIFQDLTALTESVQLENPAIQGFDCSVFTGEYITGDISPEYLDKI
ALQRNDSAKKKREKQASNLEIYNEQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtcggtattgttagccaaagtccggttaatgaatctatttatgcagca
ttaacccttttgcaacatcgtggacaagatgcggcgggtattgtaacggttgatgatgaa
aaccgtttccgcttacgtaaagctaatggcttagtcagcgatgtgttccgtcaagagcat
atgctacgcttgcaaggaaatgctggattggggcatgttcgctatcctacagcaggaagt
tctagcgtctcagaggcacaacctttttatgtaaattctccctatggtgtcactttggtg
cataacggcaatttaaccaactcagtggagttaaaagaaaaagtctttaaaactgcccgc
cgtcacgtaaacactaattcagattctgaacttcttcttaatattctcgctaatcatctt
gatcacattcctcaaaaccatctcgatccacaagatattttttatgccgttcgtaaaact
cacaatgatattcgtggtgcttatgcctgcgtagcgatgattattggacatgggatggtt
gcatttagagatccttttggtattcgtcctttggtgttgggtaaacgtgaagaaaatggc
aaaactgattatatgttcgcctctgaaacagtagctttagatattgtcggtttcgagttt
gtacgtgatattgctgcgggcgaagccgtttatgtaacgtttgatggcgagctttattca
caacaatgtaccgaaagtgcggtgttaaatccttgtatttttgagtatgtttattttgca
cgtccagattcaacgattgatggcgtctctgtttatgccgcacgtgttcacatgggcgaa
aaactcggacagaaaattgcaaaagaatgggcagatgaaattgataatattgatgtggtc
attcctattcctgaaacctccacagatattgcgttacaaatagctcgtgtactagggaaa
ccttatcgccaaggatttgtgaaaaatcgctatgttggtcgcacgtttattatgccagga
caagcacagcgtattagttctgttcgtcgcaaattgaatactattaaagctgaatttaaa
gataaaaacgtgttattggtggacgattctatcgttcgtggcacaacctctgagcaaatt
gttgaaatggctcgctcagctggtgcgaagaaaatttactttgcctctgctgctcctgaa
attcgttatccgaatgtatatggtattgatatgccgagttgtgatgaactgatcgcttat
gggcgaaatgttgatgaaattgcacatttgatcggcgtagataaattaattttccaagat
ctgaccgcacttactgaatctgttcaattggaaaatccagccattcaaggttttgattgt
tcagtattcacaggcgaatatattacaggcgatattagtcctgaatatcttgataaaatc
gcacttcaacgcaacgatagtgcaaagaaaaaacgtgaaaaacaagcatccaatcttgaa
atttataatgaacaataa

DBGET integrated database retrieval system