KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06025Help
Entry
CGSHiEE_06025     CDS       T00543                                 

Definition
(GenBank) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00430  Taurine and hypotaurine metabolism
hip00620  Pyruvate metabolism
hip00640  Propanoate metabolism
hip00680  Methane metabolism
hip01100  Metabolic pathways
hip01120  Microbial metabolism in diverse environments
hip01200  Carbon metabolism
Module
hip_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGSHiEE_06025
   00640 Propanoate metabolism
    CGSHiEE_06025
  Energy metabolism
   00680 Methane metabolism
    CGSHiEE_06025
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CGSHiEE_06025
Enzymes [BR:hip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     CGSHiEE_06025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB AAA_26 DRTGG CbiA
Motif
Other DBs
NCBI-ProteinID: ABQ98558
Position
1196802..1198937
Genome map
AA seq 711 aa AA seqDB search
MSRTIILIPVSTGVGLTSISLGLIHSLEQKGTKVAFMKPVSQPSTGEDKLDRTTSIIRTS
TSLETAEPFMLSVAESLIGQNQSDVLLEKIVANHQQLTKNNDIVVVEGLIPTRKHGYANN
INYEIAQALDAEIVLVAAPATETPTELKDRVEAAASLFGGKNNPNLLGVVVNKFNAPVDE
SGRTRPDLAEIFDSFQHNHISETEVNKLFAGSAIKLLACVPWNANLIATRAIDLVKHLGA
SIINEGEINRRIRGITFCARSLPNMVEHFRAGSLLVASADRPDVLVAAALAASNGIEIGG
ILLTGGYKIDAQINKLCRPTFEKAKLPIFRIEGNTWQTALSLQSFNLEVPVDDKERIENI
KQYISQHFNADFINNLVADSSRLPRLSPPAFRFQLTELARAAKKRIVLPEGDEPRTIKAA
VLCAERGIAECVLLADPASVQRVAEAQGVKLGKGITIINPADVRENYVDRLVELRKAKGM
TETAAREQLEDTVVLGTMMLEANEVDGLVSGAVHTTANTIRPPMQIIKTAPGSSIVSSIF
FMLLPDQVLVYGDCAVNPDPTAEQLAEIAIQSADSAKAFGIDPKVAMISYSTGTSGSGAD
VEKVKEATRIAKEKRPDLLIDGPLQYDAAVMEDVARSKAPNSPVAGKATVFVFPDLNTGN
TTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQATQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcacgattattcttatccctgtaagtacaggcgtgggtttaactagcattagt
cttggattaatccactctctcgaacaaaaaggcacgaaagttgcttttatgaaacccgtt
tctcaaccaagcactggcgaagataaattggatcgcacaacttctattattcgcactagc
actagccttgaaactgccgaaccttttatgttaagcgtggcagaatcattaattggtcaa
aatcagtctgacgtattgttagaaaaaattgtagctaaccaccaacaattaaccaaaaac
aacgatatcgttgtggtggaaggtttaattccaacaagaaaacacggttatgcaaataat
atcaactatgaaattgcacaagcattagatgcagaaatcgtattagttgcagcaccagca
actgaaaccccaaccgaattaaaagatcgtgtagaagcagcagcctctttatttggtggt
aaaaacaatccaaatcttttaggcgtagttgtaaacaaatttaatgcacctgttgatgaa
tctggtcgtacacgccccgatcttgctgaaatctttgattcattccaacacaatcatatt
agcgaaacagaagtaaacaaattatttgcaggtagtgccatcaagttattagcttgtgtg
ccttggaatgcaaatttaatcgctacacgagcaatcgacttagtcaaacatttaggtgca
tcaatcattaatgaaggggaaatcaatcgccgtattcgtggtatcactttctgcgcaaga
agtttaccaaatatggttgagcatttccgtgcaggcagtttattagtcgcttcagcagat
cgtccagatgtgcttgtagcagccgctctcgcagcgtcaaatggtattgaaatcggcggt
attttattaacaggcggctacaaaattgatgctcaaattaataaactttgccgtccaact
tttgaaaaagcgaaattaccgatcttccgtattgaaggcaatacttggcaaactgcatta
agtttacaaagttttaatctggaagtgcctgttgatgacaaagaacgtattgaaaatatt
aaacaatacattagccaacactttaatgctgactttatcaataatttagttgcagattcc
agccgtttacctcgcttatccccgcctgcattccgtttccaattaactgaacttgctcgt
gcggcgaaaaaacgtattgtgcttcctgaaggcgatgaacctcgtacaatcaaagcagcc
gtactttgtgcagaacgtggcattgcggaatgtgtgcttttagcagatcctgcatccgtt
caacgagttgcagaagcacaaggtgttaaattaggtaaaggtattacaatcatcaaccct
gctgacgttcgtgaaaactatgttgatcgtttagttgaattacgtaaagcaaaaggtatg
accgaaactgcggctcgtgagcaattagaagacactgtggtacttggcacaatgatgcta
gaagcaaatgaagtggatggtttagtatctggcgccgttcacaccactgcaaacaccatt
cgcccaccaatgcaaatcatcaaaactgcaccaggtagttcgattgtttcttctatcttc
tttatgttattaccagatcaagtgcttgtttatggtgactgtgcggtaaacccagatcca
actgcagaacaacttgctgaaattgcaattcaatcagcagattctgctaaagcatttggt
attgatccaaaagtcgcgatgatttcttactcaacaggtacatctggtagcggtgctgat
gtagaaaaagtgaaagaagcaactcgtattgcgaaagaaaaacgccctgatttattaatc
gatggcccattacaatacgatgcggctgtgatggaagatgtggctcgctctaaagcacca
aattcacctgtagcaggtaaagcaacggtatttgtattccctgacttaaatactggtaac
acgacttacaaagccgtacaacgttctgcagatttagtgtctattggcccaatgcttcaa
ggtatgcgcaaaccagtcaatgacttatctcgtggtgccttagttgatgatattgtgtac
acaattgccttaaccgcaattcaagcgacacaatag

DBGET integrated database retrieval system