KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06035Help
Entry
CGSHiEE_06035     CDS       T00543                                 

Definition
(GenBank) N5-glutamine methyltransferase
  KO
K07320  ribosomal protein L3 glutamine methyltransferase [EC:2.1.1.298]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_06035
Enzymes [BR:hip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.298  ribosomal protein L3 N5-glutamine methyltransferase
     CGSHiEE_06035
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  ribosomal protein modification factors
   CGSHiEE_06035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 PrmA Methyltransf_25 Methyltransf_18 Cons_hypoth95 Methyltransf_10 Methyltransf_15 Methyltransf_23 Met_10 UPF0020 Methyltransf_12 Ubie_methyltran N6_Mtase Methyltransf_16 N6_N4_Mtase Methyltransf_2
Motif
Other DBs
NCBI-ProteinID: ABQ98560
Position
1199648..1200592
Genome map
AA seq 314 aa AA seqDB search
METSHNQELVATILEDNVANELQTIQDFLRWTYSILNRSDVYFGQGHDNPWDESLQLVLS
GLHLPIDLPTELFNSRLTPSEKETLIQLVLTRIEQRVPVAYLTNSAWFCGHEFYVDERTI
IPRSPISALIQDRFEDLISQEPNHILDLCTGSGCIAIACAYAFPNAEVDAVDLSVDALNV
AEINISRHQLEHRVFPIQSNLFENILGQKYDLIVTNPPYVDEEDLADMPEEFHFEPELAL
GSGNDGLNITKQILKQAPDYLTENGVLVCEVGNSMISLIEQYPDVPFEWVELKNGGLGVF
AIQRKDLVKYHNLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcacataaccaagaattagttgcaactatcttggaagataatgttgcaaac
gaactgcaaaccatccaagattttctgcgttggacgtatagcattctcaatcgatctgat
gtttacttcgggcaagggcacgataatccttgggatgaaagcctgcaactcgttttaagt
ggcttacatttacccattgatttacctaccgaattatttaacagtcgattaaccccatct
gaaaaagaaaccttaattcaacttgtattaacccgaatcgaacaacgcgtacctgtggca
tatttaacaaatagtgcttggttctgcggtcacgaattttatgtcgatgaacgaaccatt
attccacgttctccaattagtgctttaattcaagatcgatttgaagatttaatttcacaa
gaaccaaatcatattctcgatctatgcacaggcagcggttgtattgccattgcttgtgct
tatgctttcccgaatgcggaagtagatgcggtagatttatcggttgatgcacttaatgtc
gcagagatcaatatttcacgccatcaattagagcatcgtgtattcccgattcaatcaaac
ttatttgaaaatattttgggacaaaaatacgatcttatcgtgaccaatccaccttatgtg
gacgaagaagatctcgccgatatgccagaagaattccattttgaaccagagttagcctta
ggttctggcaatgatggcttaaacattaccaaacaaattttaaaacaagcaccagattac
ttaaccgaaaatggcgtgttggtgtgtgaagtgggtaatagtatgattagcttaattgag
caatatccagatgtaccatttgaatgggtagaacttaaaaatggcggactaggcgtattt
gctattcagcgtaaagatttagtgaaatatcacaatctgttttaa

DBGET integrated database retrieval system