KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06045Help
Entry
CGSHiEE_06045     CDS       T00543                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase B
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_06045
Enzymes [BR:hip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     CGSHiEE_06045
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    CGSHiEE_06045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ABQ98562
Position
complement(1201633..1202706)
Genome map
AA seq 357 aa AA seqDB search
MKASQKQTQKQPHFSKDSAKKSDFSAKNDRRSVSRTARVETANTKKSVVNSDNKFLAKPK
AKPIVKASNQPKAEGEKLQKVLARAGQGSRREIETMIAAGRVSVEGKIATLGDRIDVHSG
VKVRIDGQIINLSHAQKEICRVLMYYKPEGELCTRSDPKGRATVFDRLPRLTGSRWIAVG
RLDINTSGLLLFTTDGELANRLMHPSREVEREYSVRVFGQVDDAMLARLRKGVQLEDGPA
NFKEIKFTGGVGINQWYDITLMEGRNREVRRLWESQGIQVSRLIRIRYGNIKLMKGLPRG
GWEEMDLENVNYLRELVGLPAETETKLDVKQASRRPKSGQIRKAVKRYSEMNKRYKK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctagtcaaaaacaaactcaaaaacaaccgcacttttccaaagattcagcaaag
aaaagtgatttttcagctaaaaatgatagacgttcagtatcgcgtactgcacgagtagaa
acggcaaatacgaaaaaaagtgtggttaattctgacaacaaatttttagcgaagccaaaa
gcgaaacctattgtaaaagcctcgaatcaacctaaagcagagggcgaaaaattacagaaa
gttttagcgcgtgcggggcaaggctctcgtcgtgaaattgaaacgatgattgccgcaggc
cgagtgagcgtagagggtaaaattgcgactttaggcgatcgtattgacgtacattctggc
gtgaaagtgcgtattgatggtcaaatcattaatcttagccacgcacaaaaagaaatttgc
cgtgtattaatgtattacaaacctgaaggcgaactttgtacacgtagcgacccaaaaggg
cgcgcgaccgtgtttgatcgtttgccgcgtttaacaggctctcgttggattgcggtgggg
cgtttagatattaatacatcaggtttattgctttttaccactgatggtgagctggcaaat
cgtttaatgcacccaagccgtgaagttgaacgtgaatattctgtgcgtgtatttggtcaa
gttgatgatgcgatgttagcgcgtttacgtaaaggcgttcagcttgaagatggtcctgct
aattttaaagaaattaaatttacaggcggtgtggggattaaccaatggtatgacataacc
ttgatggagggacgtaaccgtgaggttcgtcgtttgtgggaatcccaagggattcaagtt
agccgcttgattcgtattcgttacggaaatatcaaactgatgaaaggtttgcctcgtggt
ggctgggaagaaatggatcttgaaaacgtcaattatttacgtgaattggtgggattacct
gctgagactgaaacgaaattagatgtaaaacaggctagtcgtcgtccaaaatctgggcaa
attcgtaaagcggtaaaacgttattcggagatgaacaaacgttataaaaaataa

DBGET integrated database retrieval system