KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06065Help
Entry
CGSHiEE_06065     CDS       T00543                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_06065
Enzymes [BR:hip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CGSHiEE_06065
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    CGSHiEE_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: ABQ98566
UniProt: A5UCR5
Position
complement(1205584..1206675)
Genome map
AA seq 363 aa AA seqDB search
MNKLALYCRPGFEKEVAAEIADQASHLGVFGFARVQDNSGYVIFECYQPDEADRLARDIP
FNRLIFARQMMVISGLLEDLDPADRISPIVTAFEELSQQVNFAQSSELFVETADTNEAKE
LSTFCRKFTVPLRQALKKQGWLSAKATQKSGQFLHCFFVKPNCCYVGYSYVDNHSPHFMG
IPRLKFPADAPSRSTLKLEEAILTFIPRKEENKRLNENMIGVDLGACPGGWTYQLVKRGL
FVYAVDHGKMAASLHDTGRIEHCAEDGFKFQPPKRKKVDWLVCDMVEQPSRISLLIGKWL
LNGWCRETIFNLKLPMKKRYQEVILCLENLAVMLAEQNLNFEIQAKHLYHDREEITVHIA
LKP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactcgcattatattgtcgcccaggttttgagaaagaagtcgccgcagagatc
gccgatcaagcaagtcatttaggtgtatttggttttgctcgagtacaagataattcgggc
tacgtgatttttgaatgttatcaacctgatgaggcagatcgccttgcccgagacattcct
tttaatcgtttgatttttgctcgtcagatgatggttatttccggtttattggaagattta
gatcccgctgatcgtattagtcccatcgtgacggcgtttgaagagttatcacaacaagtt
aattttgctcaatctagcgagctttttgtagaaactgcagatacaaatgaagcgaaggag
ctttccactttttgtcgtaaatttaccgtacctttacgtcaggcattgaaaaaacaaggt
tggctttctgcaaaagcgactcaaaagagcggtcaatttttacattgtttttttgtaaaa
ccgaattgctgctatgtgggatattcttatgtggataatcattccccccattttatggga
atccctcgtttaaaatttccggcagatgcgccgagtcgctccacgttaaaactagaagaa
gctattttgacttttattccgcgtaaagaagagaataaacgtttaaatgaaaatatgatt
ggcgttgatttaggggcttgtcctggcggttggacatatcaattagtcaaacgcggttta
tttgtttatgctgttgatcacggaaaaatggcggcgagtttgcatgatacggggcgcatt
gaacattgcgcggaagatggttttaaatttcagcctcccaaaaggaaaaaagtggattgg
ttagtctgtgatatggtggaacaaccaagccgtatttctttattgattggcaaatggttg
ttgaatggttggtgccgagaaaccatcttcaatttaaaattacccatgaaaaaacgttat
caagaagtgatattatgtttagaaaacttggcggttatgttggcggagcagaatttgaat
tttgagattcaagcaaaacatttatatcacgatcgtgaagaaatcacggtacatatagca
ttaaaaccttga

DBGET integrated database retrieval system