KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06070Help
Entry
CGSHiEE_06070     CDS       T00543                                 

Definition
(GenBank) predicted methyltransferase
  KO
K03566  LysR family transcriptional regulator, glycine cleavage system transcriptional activator
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hip03000]
    CGSHiEE_06070
Transcription factors [BR:hip03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    CGSHiEE_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_34
Motif
Other DBs
NCBI-ProteinID: ABQ98567
Position
complement(1206668..1207561)
Genome map
AA seq 297 aa AA seqDB search
MYKRLPPLNSLKSFESAARHLSFTKAADELCVTQAAVSHQIKLLEEFLGIELFKRKNRSL
ELTELGKAYFVDINKILRRLNEATERLLMLKADPHLNISVPQTFGIQWLVPHLSEFNQLY
PQIEVRLTGVDQDEGLLNKEIDLAIYYGLGNWQNLQVDRLGEENLLILASPELLAENPII
QPEDLKKHTLIHIHTCDNWQTMANHLQLDDLNIQQGPLFSHTFMALQAAIHGQGIVLANR
LLALQEIENGSLQAVLPTNLPDPKSFYVVNHLDRLDDQKIQAFRQWIINSIKQEENE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtataaacgtttgccaccattgaattcgctaaaatcttttgagtcagctgctcgccat
ttaagttttactaaagcagcagatgagctttgtgtgacacaagcggcagttagtcatcaa
attaaattattagaagaatttttagggattgaattatttaagcgaaagaatcgttcttta
gaattaacggagcttggtaaagcttattttgttgatattaataaaattctgcgtcgctta
aatgaagcaacagagcgattgttgatgttaaaagcagatcctcacttaaacattagtgtg
ccacaaacttttggtatccaatggttagtgccacatttaagtgaatttaatcagctttat
ccgcaaattgaggttcgtttaacaggcgtggatcaagatgaaggtttgttaaataaagaa
attgatcttgctatttattatggtttgggaaattggcagaatcttcaagtagatcgtctt
ggtgaagaaaatttattgattttagcctcacccgaattgttagccgaaaatccaattatt
cagcctgaagatttaaaaaaacacacattaattcacattcatacctgtgataattggcaa
acgatggcaaatcatttacagttagatgatttaaatattcagcaagggccgttatttagc
catacatttatggcgttacaggcggctattcacgggcaaggtattgtattagctaatcgc
ttattagccttgcaagaaattgaaaatggctcattgcaagcagtgttgccgactaattta
cctgatccaaaatcattttatgtggtcaatcatcttgatcgccttgatgaccaaaaaatt
caagcattccgtcagtggattattaactcaattaaacaagaagaaaatgaataa

DBGET integrated database retrieval system