KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06075Help
Entry
CGSHiEE_06075     CDS       T00543                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00270  Cysteine and methionine metabolism
hip00280  Valine, leucine and isoleucine degradation
hip00290  Valine, leucine and isoleucine biosynthesis
hip00770  Pantothenate and CoA biosynthesis
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
hip01210  2-Oxocarboxylic acid metabolism
hip01230  Biosynthesis of amino acids
Module
hip_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
hip_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGSHiEE_06075
   00280 Valine, leucine and isoleucine degradation
    CGSHiEE_06075
   00290 Valine, leucine and isoleucine biosynthesis
    CGSHiEE_06075
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CGSHiEE_06075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hip01007]
    CGSHiEE_06075
Enzymes [BR:hip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     CGSHiEE_06075
Amino acid related enzymes [BR:hip01007]
 Aminotransferase (transaminase)
  Class IV
   CGSHiEE_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: ABQ98568
Position
1208037..1209068
Genome map
AA seq 343 aa AA seqDB search
MKDLDWNNLGFSYIKTDYRFIAHWKDGKWDEGKLTTDNTLHIHEGSTALHYGQQCFEGLK
AYRCKDGSINLFRPQANAERMQRTADRLLMPRVPTELFVRACKEVVKANQDWLGPYGSGA
TLYLRPFLIGVGENIGVKTAPEFIFSVFCCPVGAYFKGGLAPSNFITTDYDRAAPMGTGG
VKVGGNYAASLLPHELVAEQGTPERKFADAIYLDPKTHTKIEEVGAANFFGITKDNKFIT
PKSESILPSITKYSLLHIAKERLGMEAIEGDVYIDQLDQFVEAGACGTAAVITPVGGIQH
NGKFHVFYSETEVGPVTRRLYDELTGIQFGDVEAPEGWIVKVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttagactggaataaccttggttttagttatattaaaacagattaccgcttc
attgctcactggaaagatggcaaatgggacgaaggcaaactcacaacagacaatacctta
catattcacgaaggttctaccgcacttcactacggtcagcaatgttttgaaggcttaaag
gcttaccgttgcaaagatggttcaatcaacttattccgcccgcaagcaaatgcagagcgt
atgcaacgtaccgcagaccgtcttttaatgccacgcgtaccaactgaattattcgtgcgt
gcatgtaaagaagtggttaaagctaaccaagattggttaggtccttacggttctggtgca
accttatacttacgtccattcttaattggcgtgggcgaaaatatcggcgtgaaaacggca
ccagagtttattttctctgttttttgttgcccagtgggtgcttacttcaaaggtggtttg
gctccatcaaactttatcacgactgattatgaccgtgctgcaccaatgggcactggtggt
gtgaaagtgggcgggaactacgcagcaagcttacttccacacgaattagtcgcagaacaa
ggtacgccagaacgtaaatttgcggatgcaatctatttagatccaaaaactcacaccaaa
attgaagaagtcggtgcggcaaacttctttgggatcacaaaagacaataaattcatcaca
ccaaaatcagaatctattttaccaagtatcactaaatactctcttttacatatcgcaaaa
gagcgtttaggtatggaagcaattgaaggcgatgtgtatatcgatcaactcgatcaattc
gtagaagcgggtgcgtgcggtacagctgcggtgattactcctgtgggcggcattcaacac
aacggaaaattccacgtattctattcagaaactgaagtaggccctgttacccgtcgtctt
tacgatgaattaacaggcatccaattcggtgatgtcgaagcccctgaaggctggattgtg
aaagtagaataa

DBGET integrated database retrieval system