KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06080Help
Entry
CGSHiEE_06080     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABQ98569
Position
complement(1209119..1209262)
Genome map
AA seq 47 aa AA seqDB search
MKKWLLIIAGALIISACANKDVYFNGAEGSHSGVKFDKDSRQWGLNQ
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggttgttgattatcgcaggcgcgttgattatttcagcttgcgcaaataag
gatgtgtattttaacggtgcagaaggttcgcattcaggtgttaaatttgataaagattct
cgccaatggggattgaatcaataa

DBGET integrated database retrieval system