KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06095Help
Entry
CGSHiEE_06095     CDS       T00543                                 

Definition
(GenBank) predicted organic radical activating enzyme
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00790  Folate biosynthesis
hip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGSHiEE_06095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hip03016]
    CGSHiEE_06095
Enzymes [BR:hip01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     CGSHiEE_06095
Transfer RNA biogenesis [BR:hip03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CGSHiEE_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Motif
Other DBs
NCBI-ProteinID: ABQ98572
Position
1210521..1211156
Genome map
AA seq 211 aa AA seqDB search
MLMEKYHDFEPNFNIVEIFESLQGEGFNTGMPSVFVRFGKCNLDCPWCDTPYNNFKRWSV
SQILEKVRSFSSKNIIITGGEPTIVPKIEYLLEQFKSDGYFLAIETNGLKAIPAQIDYIA
TSPKSLYAHKYEKRCIPFANEVRIVMDSNMPSFCELIEQKIKAKNYYLSPCEIDGKMNLL
ETITLLGQLNQRSNKPKWQLSLQTHKLIGIE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttgatggaaaaatatcatgattttgaaccgaactttaacatagtcgaaatttttgaa
agtctgcaaggggagggcttcaatacgggaatgccaagtgtttttgtacgatttggtaaa
tgcaatctagactgtccttggtgtgatacaccttataataattttaaacgctggtctgta
tcacaaattctagaaaaagtgcggtcattttcgtcaaagaatattatcatcacaggtggt
gagccaacaattgtaccaaaaattgaatacttacttgagcaatttaaatcagatggctat
tttcttgcaattgaaaccaatggtctaaaagcaattcctgcacaaatagattatattgcg
acgagtcctaagagcctttatgctcataagtatgaaaagcgttgcattccatttgcaaat
gaagtacgtattgtaatggacagtaatatgccatcattttgtgaattgatcgagcaaaaa
ataaaagcaaagaattactatctttcaccttgtgaaattgatgggaaaatgaatttactt
gagactatcactttacttggtcaattgaatcaacgttcaaataaacctaaatggcagcta
agtttacaaacacataaattgattggtattgagtaa

DBGET integrated database retrieval system